Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GABRG1 Rabbit pAb (APR20786N)

Product Specifications

Background

The protein encoded by this gene belongs to the ligand-gated ionic channel family. It is an integral membrane protein and plays an important role in inhibiting neurotransmission by binding to the benzodiazepine receptor and opening an integral chloride channel. This gene is clustered with three other family members on chromosome 4.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GABRG1 Rabbit pAb (APR20786N) .

Synonyms

GABRG1

Gene ID

2565

UniProt

Q8N1C3

Cellular Locus

Cell junction, Cell membrane, Multi-pass membrane protein, postsynaptic cell membrane, synapse

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 53kDa Observed MW: 54kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2565

Uniprot URL

https://www.uniprot.org/uniprot/Q8N1C3

AA Sequence

HSCPLEFSSYGYPKNEIEYKWKKPSVEVADPKYWRLYQFAFVGLRNSTEITHTISGDYVIM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADPRHL1 (NM_138430) Human Tagged ORF Clone
RG215044 10 µg

ADPRHL1 (NM_138430) Human Tagged ORF Clone

Sign In for Pricing
View Details
MEAK7 (TLDC1) (NM_020947) Human Tagged Lenti ORF Clone
RC209287L4 10 µg

MEAK7 (TLDC1) (NM_020947) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Haemophilus parasuis serovar 5 Inosose dehydratase (iolE)
MBS1140526-01 0.02 mg (E-Coli)

Recombinant Haemophilus parasuis serovar 5 Inosose dehydratase (iolE)

Sign In for Pricing
View Details
Recombinant Haemophilus parasuis serovar 5 Inosose dehydratase (iolE)
MBS1140526-02 0.02 mg (Yeast)

Recombinant Haemophilus parasuis serovar 5 Inosose dehydratase (iolE)

Sign In for Pricing
View Details
Recombinant Haemophilus parasuis serovar 5 Inosose dehydratase (iolE)
MBS1140526-03 0.1 mg (E-Coli)

Recombinant Haemophilus parasuis serovar 5 Inosose dehydratase (iolE)

Sign In for Pricing
View Details
Recombinant Haemophilus parasuis serovar 5 Inosose dehydratase (iolE)
MBS1140526-04 0.1 mg (Yeast)

Recombinant Haemophilus parasuis serovar 5 Inosose dehydratase (iolE)

Sign In for Pricing
View Details