Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDH8 Rabbit pAb (APR20781N)

Product Specifications

Background

This gene encodes a type II classical cadherin from the cadherin superfamily, integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain. The extracellular domain consists of 5 subdomains, each containing a cadherin motif, and appears to determine the specificity of the protein's homophilic cell adhesion activity. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. This particular cadherin is expressed in brain and is putatively involved in synaptic adhesion, axon outgrowth and guidance.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CDH8 Rabbit pAb (APR20781N) .

Synonyms

CDH8; Nbla04261

Gene ID

1006

UniProt

P55286

Cellular Locus

Cell membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 88kDa Observed MW: 110kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1006

Uniprot URL

https://www.uniprot.org/uniprot/P55286

AA Sequence

YEAFLCENGKPGQVIQTVSAMDKDDPKNGHYFLYSLLPEMVNNPNFTIKKNEDNSLSILAKHNGFNRQKQEVYLLPIIISDSGNPPLSSTSTLTIRVCGCSNDGVVQSCNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NY-ESO-1 (CTAG1B) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C12]
TA505967BM 100 µL

NY-ESO-1 (CTAG1B) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C12]

Sign In for Pricing
View Details
Calcium Phenylpyruvate
TRC-C145763-50MG 50 mg

Calcium Phenylpyruvate

Sign In for Pricing
View Details
Oct-1 (POU2F1) Rabbit Polyclonal Antibody
AP06254PU-N 100 µg

Oct-1 (POU2F1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Indole-3-carboxaldehyde- 13C8
TRC-I614993-2.5MG 2.5 mg

Indole-3-carboxaldehyde- 13C8

Sign In for Pricing
View Details
ITCH Human Gene Knockout Kit (CRISPR)
KN420408 1 Kit

ITCH Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse TRACP-5b (Tartrate-Resistant Acid Phosphatase 5b) CLIA Kit
E-CL-M0631-01 24 Tests

Mouse TRACP-5b (Tartrate-Resistant Acid Phosphatase 5b) CLIA Kit

Sign In for Pricing
View Details