Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSMD2 Rabbit pAb (APR20775N)

Product Specifications

Background

The protein encoded by this gene is thought to be involved in the control of complement. Defects in this gene have been associated with schizophrenia. This gene may act as a tumor suppressor for colorectal cancer.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CSMD2 Rabbit pAb (APR20775N) .

Synonyms

CSMD2; dJ1007G16.1; dJ1007G16.2; dJ947L8.1

Gene ID

114784

UniProt

Q7Z408

Cellular Locus

Cell membrane, Single-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 380kDa Observed MW: 280kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=114784

Uniprot URL

https://www.uniprot.org/uniprot/Q7Z408

AA Sequence

TSHETTVYFHSDHSQNRPGFKLEYQDLTYSHQISSFLRGFDLSELERTNSTPPVAASYVWDLDPGCEAYELQECPDPEPFANGIVRGAGYNVGQSVTFECL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Scand1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3168905 3x 1.0 µg

Scand1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
PE/iFluor® 750 Anti-human CD85j Antibody *GHI/75*
108511T2-AAT 500 Tests

PE/iFluor® 750 Anti-human CD85j Antibody *GHI/75*

Sign In for Pricing
View Details
Polyclonal MUC13 Antibody (Extracellular Domain)
APR02082G 0.05mg

Polyclonal MUC13 Antibody (Extracellular Domain)

Sign In for Pricing
View Details
Human Non POU Domain Containing Octamer Binding Protein (NONO) ELISA Kit
DLR-NONO-Hu-01 48 Tests

Human Non POU Domain Containing Octamer Binding Protein (NONO) ELISA Kit

Sign In for Pricing
View Details
Human Non POU Domain Containing Octamer Binding Protein (NONO) ELISA Kit
DLR-NONO-Hu-02 96 Tests

Human Non POU Domain Containing Octamer Binding Protein (NONO) ELISA Kit

Sign In for Pricing
View Details
IHCAb™ CD45 (LCA) (PT1659) mouse mAb
B-IMW6018-100uL 100 µL

IHCAb™ CD45 (LCA) (PT1659) mouse mAb

Sign In for Pricing
View Details