Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR33 Rabbit pAb (APR20758N)

Product Specifications

Background

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is highly expressed in testis and the protein is localized to the nucleus. This gene may play important roles in the mechanisms of cytodifferentiation and/or DNA recombination. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality WDR33 Rabbit pAb (APR20758N) .

Synonyms

WDR33; NET14; WDC146

Gene ID

74320

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 30kDa/38kDa/145kDa Observed MW: 145kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=74320

AA Sequence

MATEIGSPPRFFHMPRFQHQAPRQLFYKRPDFAQQQAMQQLTFDGKRMRKAVNRKTIDYNPSVIKYLENRIWQRDQRDMRAIQPDAGYYNDLVPPIGMLNNPMNAVTTKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETILQAHDSPVRAMTWSHNDMWMLTADHGGYVKYWQSNMNNVKMFQAHKEAIREA

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Monkey U3 small nucleolar RNA-associated protein 15 homolog (UTP15) ELISA Kit
MBS7249640-01 48 Well

Monkey U3 small nucleolar RNA-associated protein 15 homolog (UTP15) ELISA Kit

Ask
View Details
Monkey U3 small nucleolar RNA-associated protein 15 homolog (UTP15) ELISA Kit
MBS7249640-02 96 Well

Monkey U3 small nucleolar RNA-associated protein 15 homolog (UTP15) ELISA Kit

Ask
View Details
Monkey U3 small nucleolar RNA-associated protein 15 homolog (UTP15) ELISA Kit
MBS7249640-03 5x 96 Well

Monkey U3 small nucleolar RNA-associated protein 15 homolog (UTP15) ELISA Kit

Ask
View Details
Monkey U3 small nucleolar RNA-associated protein 15 homolog (UTP15) ELISA Kit
MBS7249640-04 10x 96 Well

Monkey U3 small nucleolar RNA-associated protein 15 homolog (UTP15) ELISA Kit

Ask
View Details
Puromycin 2HCl 10mg
A14268-10 10 mg

Puromycin 2HCl 10mg

Ask
View Details
IFI27 (NM_005532) Human Tagged ORF Clone
RG201952 10 µg

IFI27 (NM_005532) Human Tagged ORF Clone

Ask
View Details