Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WNT7A Rabbit pAb (APR20744N)

Product Specifications

Background

This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is involved in the development of the anterior-posterior axis in the female reproductive tract, and also plays a critical role in uterine smooth muscle pattering and maintenance of adult uterine function. Mutations in this gene are associated with Fuhrmann and Al-Awadi/Raas-Rothschild/Schinzel phocomelia syndromes.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality WNT7A Rabbit pAb (APR20744N) .

Synonyms

WNT7A

Gene ID

7476

UniProt

O00755

Cellular Locus

Secreted, extracellular matrix, extracellular space

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 39kDa Observed MW: 39kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7476

Uniprot URL

https://www.uniprot.org/uniprot/O00755

AA Sequence

GEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAITAACTQGNLSDCGCDKEKQGQYHRDEGWKWG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human BAK MAb (Clone 564305)
MAB8161-SP 25 µg

Human BAK MAb (Clone 564305)

Sign In for Pricing
View Details
IGF1R, NT (K66) (IGF1R, Insulin-like growth factor 1 receptor, Insulin-like growth factor I receptor, CD221, Insulin-like growth factor 1 receptor alpha chain, Insulin-like growth factor 1 receptor beta chain) (Biotin) discontinued
036906-Biotin 200 µL

IGF1R, NT (K66) (IGF1R, Insulin-like growth factor 1 receptor, Insulin-like growth factor I receptor, CD221, Insulin-like growth factor 1 receptor alpha chain, Insulin-like growth factor 1 receptor beta chain) (Biotin) discontinued

Sign In for Pricing
View Details
Capillary tubes
2067860/9 1 Each

Capillary tubes

Sign In for Pricing
View Details
GTPBP8 Adenovirus (Rat)
22824056 1.0 mL

GTPBP8 Adenovirus (Rat)

Sign In for Pricing
View Details
Anti-GLIPR2 Antibody Picoband®, PE Conjugate
A10232-1-PE 100 µg/Vial

Anti-GLIPR2 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
Recombinant Vaccinia virus Profilin (VACWR167)
MBS1384753-01 0.02 mg (E-Coli)

Recombinant Vaccinia virus Profilin (VACWR167)

Sign In for Pricing
View Details