Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WNT7A Rabbit pAb (APR20744N)

Product Specifications

Background

This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is involved in the development of the anterior-posterior axis in the female reproductive tract, and also plays a critical role in uterine smooth muscle pattering and maintenance of adult uterine function. Mutations in this gene are associated with Fuhrmann and Al-Awadi/Raas-Rothschild/Schinzel phocomelia syndromes.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality WNT7A Rabbit pAb (APR20744N) .

Synonyms

WNT7A

Gene ID

7476

UniProt

O00755

Cellular Locus

Secreted, extracellular matrix, extracellular space

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 39kDa Observed MW: 39kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7476

Uniprot URL

https://www.uniprot.org/uniprot/O00755

AA Sequence

GEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAITAACTQGNLSDCGCDKEKQGQYHRDEGWKWG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Tomato bushy stunt virus Movement protein (ORF3)
MBS1120072-01 0.02 mg (E-Coli)

Recombinant Tomato bushy stunt virus Movement protein (ORF3)

Sign In for Pricing
View Details
Recombinant Tomato bushy stunt virus Movement protein (ORF3)
MBS1120072-02 0.1 mg (E-Coli)

Recombinant Tomato bushy stunt virus Movement protein (ORF3)

Sign In for Pricing
View Details
Recombinant Tomato bushy stunt virus Movement protein (ORF3)
MBS1120072-03 0.02 mg (Yeast)

Recombinant Tomato bushy stunt virus Movement protein (ORF3)

Sign In for Pricing
View Details
Recombinant Tomato bushy stunt virus Movement protein (ORF3)
MBS1120072-04 0.1 mg (Yeast)

Recombinant Tomato bushy stunt virus Movement protein (ORF3)

Sign In for Pricing
View Details
Recombinant Tomato bushy stunt virus Movement protein (ORF3)
MBS1120072-05 0.02 mg (Baculovirus)

Recombinant Tomato bushy stunt virus Movement protein (ORF3)

Sign In for Pricing
View Details
Recombinant Tomato bushy stunt virus Movement protein (ORF3)
MBS1120072-06 0.02 mg (Mammalian-Cell)

Recombinant Tomato bushy stunt virus Movement protein (ORF3)

Sign In for Pricing
View Details