Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PKC zeta Rabbit pAb (APR20729N)

Product Specifications

Background

Protein kinase C (PKC) zeta is a member of the PKC family of serine/threonine kinases which are involved in a variety of cellular processes such as proliferation, differentiation and secretion. Unlike the classical PKC isoenzymes which are calcium-dependent, PKC zeta exhibits a kinase activity which is independent of calcium and diacylglycerol but not of phosphatidylserine. Furthermore, it is insensitive to typical PKC inhibitors and cannot be activated by phorbol ester. Unlike the classical PKC isoenzymes, it has only a single zinc finger module. These structural and biochemical properties indicate that the zeta subspecies is related to, but distinct from other isoenzymes of PKC. Alternative splicing results in multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PKC zeta Rabbit pAb (APR20729N) .

Synonyms

PRKCZ; PKC-ZETA; PKC2

Gene ID

5590

UniProt

Q05513

Cellular Locus

Cell junction, Cytoplasm, Endosome

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 46kDa/56kDa/67kDa Observed MW: 70KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5590

Uniprot URL

https://www.uniprot.org/uniprot/Q05513

AA Sequence

IITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAK1 (Phospho-Thr184) Polyclonal Conjugated Antibody
MBS9437584-01 0.1 mL (Biotin)

TAK1 (Phospho-Thr184) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
TAK1 (Phospho-Thr184) Polyclonal Conjugated Antibody
MBS9437584-02 0.1 mL (AF350)

TAK1 (Phospho-Thr184) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
TAK1 (Phospho-Thr184) Polyclonal Conjugated Antibody
MBS9437584-03 0.1 mL (AF405)

TAK1 (Phospho-Thr184) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
TAK1 (Phospho-Thr184) Polyclonal Conjugated Antibody
MBS9437584-04 0.1 mL (AF488)

TAK1 (Phospho-Thr184) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
TAK1 (Phospho-Thr184) Polyclonal Conjugated Antibody
MBS9437584-05 0.1 mL (AF555)

TAK1 (Phospho-Thr184) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
TAK1 (Phospho-Thr184) Polyclonal Conjugated Antibody
MBS9437584-06 0.1 mL (AF594)

TAK1 (Phospho-Thr184) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details