Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFI27 Rabbit pAb (APR20726N)

Product Specifications

Background

Probable adapter protein involved in different biological processes. Part of the signaling pathways that lead to apoptosis. Involved in type-I interferon-induced apoptosis characterized by a rapid and robust release of cytochrome C from the mitochondria and activation of BAX and caspases 2, 3, 6, 8 and 9. Also functions in TNFSF10-induced apoptosis. May also have a function in the nucleus, where it may be involved in the interferon-induced negative regulation of the transcriptional activity of NR4A1, NR4A2 and NR4A3 through the enhancement of XPO1-mediated nuclear export of these nuclear receptors. May thereby play a role in the vascular response to injury (By similarity. In the innate immune response, has an antiviral activity towards hepatitis C virus/HCV. May prevent the replication of the virus by recruiting both the hepatitis C virus non-structural protein 5A/NS5A and the ubiquitination machinery via SKP2, promoting the ubiquitin-mediated proteasomal degradation of NS5A.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality IFI27 Rabbit pAb (APR20726N) .

Synonyms

IFI27; FAM14D; ISG12; ISG12A; P27

Gene ID

3429

UniProt

P40305

Cellular Locus

Membrane, Mitochondrion, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 11kDa Observed MW: 11kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3429

Uniprot URL

https://www.uniprot.org/uniprot/P40305

AA Sequence

MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INTS1 Rabbit Polyclonal Antibody
E53P09248 100 µL

INTS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TPRA1 Peptide - C-terminal region
MBS3243036-01 0.1 mg

TPRA1 Peptide - C-terminal region

Sign In for Pricing
View Details
TPRA1 Peptide - C-terminal region
MBS3243036-02 5x 0.1 mg

TPRA1 Peptide - C-terminal region

Sign In for Pricing
View Details
ZNF28 Antibody (N-term)
orb29508-01 50 µL

ZNF28 Antibody (N-term)

Sign In for Pricing
View Details
ZNF28 Antibody (N-term)
orb29508-02 100 µL

ZNF28 Antibody (N-term)

Sign In for Pricing
View Details
SRSF3 Antibody, mAb, Rabbit
A05091-50 50 µL

SRSF3 Antibody, mAb, Rabbit

Sign In for Pricing
View Details