Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LGR6 Rabbit pAb (APR20725N)

Product Specifications

Background

This gene encodes a member of the leucine-rich repeat-containing subgroup of the G protein-coupled 7-transmembrane protein superfamily. The encoded protein is a glycoprotein hormone receptor with a large N-terminal extracellular domain that contains leucine-rich repeats important for the formation of a horseshoe-shaped interaction motif for ligand binding. Alternative splicing of this gene results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality LGR6 Rabbit pAb (APR20725N) .

Synonyms

LGR6; GPCR; VTS20631

Gene ID

59352

UniProt

Q9HBX8

Cellular Locus

Cell membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 89kDa/99kDa/104kDa Observed MW: 98kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=59352

Uniprot URL

https://www.uniprot.org/uniprot/Q9HBX8

AA Sequence

RRLRPRAGDSGPLAYAAAGELEKSSCDSTQALVAFSDVDLILEASEAGRPPGLETYGFPSVTLISCQQPGAPRLEGSHCVEPEGNHFGNPQPSMDGELLLR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Acetyl-Tubulin ? (Lys112) Polyclonal Antibody
MF-0067394-01 50 µL

Anti-Acetyl-Tubulin ? (Lys112) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Acetyl-Tubulin ? (Lys112) Polyclonal Antibody
MF-0067394-02 100 µL

Anti-Acetyl-Tubulin ? (Lys112) Polyclonal Antibody

Sign In for Pricing
View Details
SPC24 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
45241061 1.0 µg DNA

SPC24 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Mouse PHOSPHO1 shRNA Plasmid
abx982317-01 150 µg

Mouse PHOSPHO1 shRNA Plasmid

Sign In for Pricing
View Details
Mouse PHOSPHO1 shRNA Plasmid
abx982317-02 300 µg

Mouse PHOSPHO1 shRNA Plasmid

Sign In for Pricing
View Details
CCDC157 (NM_001017437) Human Tagged ORF Clone Lentiviral Particle
RC210351L3V 200 µL

CCDC157 (NM_001017437) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details