Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LGR6 Rabbit pAb (APR20725N)

Product Specifications

Background

This gene encodes a member of the leucine-rich repeat-containing subgroup of the G protein-coupled 7-transmembrane protein superfamily. The encoded protein is a glycoprotein hormone receptor with a large N-terminal extracellular domain that contains leucine-rich repeats important for the formation of a horseshoe-shaped interaction motif for ligand binding. Alternative splicing of this gene results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality LGR6 Rabbit pAb (APR20725N) .

Synonyms

LGR6; GPCR; VTS20631

Gene ID

59352

UniProt

Q9HBX8

Cellular Locus

Cell membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 89kDa/99kDa/104kDa Observed MW: 98kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=59352

Uniprot URL

https://www.uniprot.org/uniprot/Q9HBX8

AA Sequence

RRLRPRAGDSGPLAYAAAGELEKSSCDSTQALVAFSDVDLILEASEAGRPPGLETYGFPSVTLISCQQPGAPRLEGSHCVEPEGNHFGNPQPSMDGELLLR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SQSTM1 Knockout Cell Line-Hep G2
RK-0984 1x 10^6

SQSTM1 Knockout Cell Line-Hep G2

Sign In for Pricing
View Details
KRT8P8 ORF Vector (Human) (pORF)
ORF022497 1.0 µg DNA

KRT8P8 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
TMEM68 Adenovirus (Human)
47082051 1.0 mL

TMEM68 Adenovirus (Human)

Sign In for Pricing
View Details
Krt78 Mouse shRNA Lentiviral Particle (Locus ID 332131)
TL509823V 500 µL Each

Krt78 Mouse shRNA Lentiviral Particle (Locus ID 332131)

Sign In for Pricing
View Details
Mouse Monoclonal HE4/WFDC2 Antibody (OTI1E12) [DyLight 680]
NBP2-71599FR 0.1 mL

Mouse Monoclonal HE4/WFDC2 Antibody (OTI1E12) [DyLight 680]

Sign In for Pricing
View Details
MAGE-D4B CRISPR Activation Plasmid (h)
sc-417104-ACT 20 µg

MAGE-D4B CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details