What is the catalog number for AKAP5 Rabbit pAb (APR20645N)?

The catalog number for AKAP5 Rabbit pAb (APR20645N) is APR20645N.

What sizes are available for AKAP5 Rabbit pAb (APR20645N)?

AKAP5 Rabbit pAb (APR20645N) is available in the following size(s): 50 µL, 100 µL, 200 µL.

How many pack sizes does AKAP5 Rabbit pAb (APR20645N) come in?

AKAP5 Rabbit pAb (APR20645N) is available in 3 different pack sizes.

Is AKAP5 Rabbit pAb (APR20645N) in stock?

AKAP5 Rabbit pAb (APR20645N) is currently made to order / not held in immediate stock. Contact us for lead time.

AKAP5 Rabbit pAb (APR20645N)

Product Specifications

Background

The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein binds to the RII-beta regulatory subunit of PKA, and also to protein kinase C and the phosphatase calcineurin. It is predominantly expressed in cerebral cortex and may anchor the PKA protein at postsynaptic densities (PSD) and be involved in the regulation of postsynaptic events. It is also expressed in T lymphocytes and may function to inhibit interleukin-2 transcription by disrupting calcineurin-dependent dephosphorylation of NFAT.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality AKAP5 Rabbit pAb (APR20645N) .

Synonyms

AKAP5; AKAP75; AKAP79; H21

Gene ID

9495

UniProt

P24588

Cellular Locus

Lipid-anchor, Membrane

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 47kDa Observed MW: 47kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9495

Uniprot URL

https://www.uniprot.org/uniprot/P24588

AA Sequence

METTISEIHVENKDEKRSAEGSPGAERQKEKASMLCFKRRKKAAKALKPKAGSEAADVARKCPQEAGASDQPEPTRGAWASLKRLVTRRKRSESSKQQKPLEGEMQPAINAEDADLSKKKAKSRLKIPCIKFPRGPKRSNHSKIIEDSDCSIKVQEEAEILDIQTQTPLNDQATKAKSTQDLSEGISRKDGDEVCESNVSNSTTSGEKVISVELGLDNGHSAIQTGTLILEEIETIKEKQDVQPQQASPLETSETDHQQPVLSDVPPLPA