Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DOK2 Rabbit pAb (APR20638N)

Product Specifications

Background

The protein encoded by this gene is constitutively tyrosine phosphorylated in hematopoietic progenitors isolated from chronic myelogenous leukemia (CML) patients in the chronic phase. It may be a critical substrate for p210 (bcr/abl), a chimeric protein whose presence is associated with CML. This encoded protein binds p120 (RasGAP) from CML cells.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DOK2 Rabbit pAb (APR20638N) .

Synonyms

DOK2; p56DOK; p56dok-2

Gene ID

9046

UniProt

O60496

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 45kDa Observed MW: 45kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9046

Uniprot URL

https://www.uniprot.org/uniprot/O60496

AA Sequence

MGDGAVKQGFLYLQQQQTFGKKWRRFGASLYGGSDCALARLELQEGPEKPRRCEAARKVIRLSDCLRVAEAGGEASSPRDTSAFFLETKERLYLLAAPAAERGDWVQAICLLAFPGQRKELSGPEGKQSRPCMEENELYSSAVTVGPHKEFAVTMRPTEASERCHLRGSYTLRAGESALELWGGPEPGTQLYDWPYRFLRRFGRDKVTFSFEAGRRCVSGEGNFEFETRQGNEIFLALEEAISAQKNAAPATPQPQPATI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHYH Rabbit Polyclonal Antibody
TA379901 100 µL

PHYH Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PCR Plates
P9602-N 50 Units/Pack

PCR Plates

Sign In for Pricing
View Details
Ska2 Mouse Gene Knockout Kit (CRISPR)
KN515818 1 Kit

Ska2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Slc6a17 Mouse Gene Knockout Kit (CRISPR)
KN516173 1 Kit

Slc6a17 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PTTG1IP Rabbit Polyclonal Antibody
TA392779 100 µL

PTTG1IP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS505315 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details