Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF8 Rabbit pAb (APR20637N)

Product Specifications

Background

The protein encoded by this gene contains a RING finger motif and an FHA domain. This protein has been shown to interact with several class II ubiquitin-conjugating enzymes (E2), including UBE2E1/UBCH6, UBE2E2, and UBE2E3, and may act as an ubiquitin ligase (E3) in the ubiquitination of certain nuclear proteins. This protein is also known to play a role in the DNA damage response and depletion of this protein causes cell growth inhibition and cell cycle arrest. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RNF8 Rabbit pAb (APR20637N) .

Synonyms

RNF8; hRNF8

Gene ID

9025

UniProt

O76064

Cellular Locus

Chromosome, Midbody, Nucleus, telomere

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 10kDa/50kDa/55kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9025

Uniprot URL

https://www.uniprot.org/uniprot/O76064

AA Sequence

MGEPGFFVTGDRAGGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQLVSKICPLMISRNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEYEYEVTEEDWETIYPCLSPKNDQMIEKNKELRTKRKFSLDELAGPGAEGPSNLKSKINKVSCESGQPVKSQGKGEVASTPSDNLDPKLTALEPSKTTGAPIYPGFPKVTEVHHEQKASNSSASQRSLQMFKVTMSRILRLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytohesin 1 (B2-1, CLM1, CTH-1, CYTIP, Cytoadhesin 1, D17S811E, Homolog of Secretory Protein SEC7, Pleckstrin Homology Sec7 and Coiled/Coil Domains 1, PSCD1) (MaxLight 490) discontinued
C9096-05C-ML490 100 µL

Cytohesin 1 (B2-1, CLM1, CTH-1, CYTIP, Cytoadhesin 1, D17S811E, Homolog of Secretory Protein SEC7, Pleckstrin Homology Sec7 and Coiled/Coil Domains 1, PSCD1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
ELISA Kit for Killer Cell Lectin Like Receptor Subfamily C, Member 2 (KLRC2)
TRV-0063304-01 24 Tests

ELISA Kit for Killer Cell Lectin Like Receptor Subfamily C, Member 2 (KLRC2)

Sign In for Pricing
View Details
ELISA Kit for Killer Cell Lectin Like Receptor Subfamily C, Member 2 (KLRC2)
TRV-0063304-02 48 Tests

ELISA Kit for Killer Cell Lectin Like Receptor Subfamily C, Member 2 (KLRC2)

Sign In for Pricing
View Details
ELISA Kit for Killer Cell Lectin Like Receptor Subfamily C, Member 2 (KLRC2)
TRV-0063304-03 96 Tests

ELISA Kit for Killer Cell Lectin Like Receptor Subfamily C, Member 2 (KLRC2)

Sign In for Pricing
View Details
ELISA Kit for Killer Cell Lectin Like Receptor Subfamily C, Member 2 (KLRC2)
TRV-0063304-04 5x 96 Tests

ELISA Kit for Killer Cell Lectin Like Receptor Subfamily C, Member 2 (KLRC2)

Sign In for Pricing
View Details
ELISA Kit for Killer Cell Lectin Like Receptor Subfamily C, Member 2 (KLRC2)
TRV-0063304-05 10x 96 Tests

ELISA Kit for Killer Cell Lectin Like Receptor Subfamily C, Member 2 (KLRC2)

Sign In for Pricing
View Details