Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF195 Rabbit pAb (APR20628N)

Product Specifications

Background

This gene encodes a protein belonging to the Krueppel C2H2-type zinc-finger protein family. These family members are transcription factors that are implicated in a variety of cellular processes. This gene is located near the centromeric border of chromosome 11p15.5, next to an imprinted domain that is associated with maternal-specific loss of heterozygosity in Wilms' tumors. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ZNF195 Rabbit pAb (APR20628N) .

Synonyms

ZNF195; HRF1; ZNFP104

Gene ID

7748

UniProt

O14628

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 10kDa/64kDa/69kDa/70kDa/72kDa Observed MW: 60kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7748

Uniprot URL

https://www.uniprot.org/uniprot/O14628

AA Sequence

MTLLTFRDVAIEFSLEEWKCLDLAQQNLYRDVMLENYRNLFSVGLTVCKPGLITCLEQRKEPWNVKRQEAADGHPEMGFHHATQACLELLGSSDLPASASQSAGITGVNHRAQPGLNVSVDKFTAMSSHFTQDLLPEQGIQDAFPKRILRGYGNCGLDNLYLRKDWESLDECKLQKDYNGLNQCSSTTHSKIFQYNKYVKIFDNFSNLHRRNISNTGEKPFKCQECGKSFQMLSFLTEHQKIHTGKKFQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal TCP1 alpha Antibody (23c (CTA-123)) [HRP]
NBP2-50328H 0.1 mL

Rat Monoclonal TCP1 alpha Antibody (23c (CTA-123)) [HRP]

Sign In for Pricing
View Details
Pannexin-3 Double Nickase Plasmid (h)
sc-406424-NIC 20 µg

Pannexin-3 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Polyclonal Antibody to Klotho Beta (KLb)
MBS2027743-01 0.1 mL

Polyclonal Antibody to Klotho Beta (KLb)

Sign In for Pricing
View Details
Polyclonal Antibody to Klotho Beta (KLb)
MBS2027743-02 0.2 mL

Polyclonal Antibody to Klotho Beta (KLb)

Sign In for Pricing
View Details
Polyclonal Antibody to Klotho Beta (KLb)
MBS2027743-03 0.5 mL

Polyclonal Antibody to Klotho Beta (KLb)

Sign In for Pricing
View Details
Polyclonal Antibody to Klotho Beta (KLb)
MBS2027743-04 1 mL

Polyclonal Antibody to Klotho Beta (KLb)

Sign In for Pricing
View Details