Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Osteopontin Rabbit pAb (APR20620N)

Product Specifications

Background

The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. The encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein. This protein is also a cytokine that upregulates expression of interferon-gamma and interleukin-12. Several transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Osteopontin Rabbit pAb (APR20617N2) .

Synonyms

BNSP; BSPI; ETA-1; OPN; Osteopontin; SPP1

Gene ID

6696

UniProt

P10451

Cellular Locus

Secreted

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 32kDa/33kDa/35kDa Observed MW: 33kDa/70kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6696

Uniprot URL

https://www.uniprot.org/uniprot/P10451

AA Sequence

NDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDITSHMESEELNGAYKAI

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TNFSF14 (Tumor Necrosis Factor Ligand Superfamily Member 14, Herpes Virus Entry mediator Ligand, HVEM-L, Herpesvirus Entry mediator Ligand, CD258, Cleaved into the Following 2 Chains, Tumor Necrosis Factor Ligand Superfamily Member 14, Membrane Form) (Biotin)
338534-01 50 µg

TNFSF14 (Tumor Necrosis Factor Ligand Superfamily Member 14, Herpes Virus Entry mediator Ligand, HVEM-L, Herpesvirus Entry mediator Ligand, CD258, Cleaved into the Following 2 Chains, Tumor Necrosis Factor Ligand Superfamily Member 14, Membrane Form) (Biotin)

Ask
View Details
TNFSF14 (Tumor Necrosis Factor Ligand Superfamily Member 14, Herpes Virus Entry mediator Ligand, HVEM-L, Herpesvirus Entry mediator Ligand, CD258, Cleaved into the Following 2 Chains, Tumor Necrosis Factor Ligand Superfamily Member 14, Membrane Form) (Biotin)
338534-02 100 µg

TNFSF14 (Tumor Necrosis Factor Ligand Superfamily Member 14, Herpes Virus Entry mediator Ligand, HVEM-L, Herpesvirus Entry mediator Ligand, CD258, Cleaved into the Following 2 Chains, Tumor Necrosis Factor Ligand Superfamily Member 14, Membrane Form) (Biotin)

Ask
View Details
MEF2D (Myocyte Enhancer Factor 2D, DKFZp686I1536) (HRP)
MBS6180398-01 0.1 mL

MEF2D (Myocyte Enhancer Factor 2D, DKFZp686I1536) (HRP)

Ask
View Details
MEF2D (Myocyte Enhancer Factor 2D, DKFZp686I1536) (HRP)
MBS6180398-02 5x 0.1 mL

MEF2D (Myocyte Enhancer Factor 2D, DKFZp686I1536) (HRP)

Ask
View Details
Cy3 Linked Polyclonal Antibody to GATA Binding Protein 5 (GATA5)
MBS2129174-01 0.1 mL

Cy3 Linked Polyclonal Antibody to GATA Binding Protein 5 (GATA5)

Ask
View Details
Cy3 Linked Polyclonal Antibody to GATA Binding Protein 5 (GATA5)
MBS2129174-02 0.2 mL

Cy3 Linked Polyclonal Antibody to GATA Binding Protein 5 (GATA5)

Ask
View Details