Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPL Rabbit pAb (APR20610N)

Product Specifications

Background

The protein encoded by this gene is a component of desmosomes and of the epidermal cornified envelope in keratinocytes. The N-terminal domain of this protein interacts with the plasma membrane and its C-terminus interacts with intermediate filaments. Through its rod domain, this protein forms complexes with envoplakin. This protein may serve as a link between the cornified envelope and desmosomes as well as intermediate filaments. AKT1/PKB, a protein kinase mediating a variety of cell growth and survival signaling processes, is reported to interact with this protein, suggesting a possible role for this protein as a localization signal in AKT1-mediated signaling.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PPL Rabbit pAb (APR20610N) .

Synonyms

PPL

Gene ID

5493

UniProt

O60437

Cellular Locus

Cell junction, Cell membrane, Cytoplasm, Mitochondrion, Nucleus, cytoskeleton, desmosome

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 204kDa Observed MW: 205kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5493

Uniprot URL

https://www.uniprot.org/uniprot/O60437

AA Sequence

MNSLFRKRNKGKYSPTVQTRSISNKELSELIEQLQKNADQVEKNIVDTEAKMQSDLARLQEGRQPEHRDVTLQKVLDSEKLLYVLEADAAIAKHMKHPQGDMIAEDIRQLKERVTNLRGKHKQIYRLAVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NPRC/NPR3 Alexa Fluor 647 Antibody (1060830)
FAB102331R-100UG 100 µg

Human NPRC/NPR3 Alexa Fluor 647 Antibody (1060830)

Sign In for Pricing
View Details
SPAG5 Rabbit Polyclonal Antibody
E10G07618 100 µL

SPAG5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SOX2 (Transcript ion Factor SOX-2, MGC2413) (MaxLight 750) discontinued
133719-ML750 100 µL

SOX2 (Transcript ion Factor SOX-2, MGC2413) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Protein Kinase C Beta (PRKCB) Antibody
abx004482-01 60 µL

Protein Kinase C Beta (PRKCB) Antibody

Sign In for Pricing
View Details
Protein Kinase C Beta (PRKCB) Antibody
abx004482-02 120 µL

Protein Kinase C Beta (PRKCB) Antibody

Sign In for Pricing
View Details
Protein Kinase C Beta (PRKCB) Antibody
abx004482-03 200 µL

Protein Kinase C Beta (PRKCB) Antibody

Sign In for Pricing
View Details