Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NTRK3 Rabbit pAb (APR20592N)

Product Specifications

Background

This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. Mutations in this gene have been associated with medulloblastomas, secretory breast carcinomas and other cancers. Several transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NTRK3 Rabbit pAb (APR20592N) .

Synonyms

NTRK3; GP145-TrkC; TRKC; gp145 (trkC)

Gene ID

4916

UniProt

Q16288

Cellular Locus

Membrane, Single-pass type I membrane protein

Applications

WB (Homo sapiens, Rattus norvegicus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 68kDa/91kDa/92kDa/93kDa/94kDa Observed MW: 115kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4916

Uniprot URL

https://www.uniprot.org/uniprot/Q16288

AA Sequence

KTEINCRRPDDGNLFPLLEGQDSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQPRAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQEQGEAKLNSQNLYCINADGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCIAENVVGMSNASVALT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thyroglobulin (Thyroidal Cell Marker) (TGB/1970R), 0.2mg/mL
BNUB1970-500 1x 500 µL

Thyroglobulin (Thyroidal Cell Marker) (TGB/1970R), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant Human SIRPB1/CD172b Protein (His Tag)
PKSH033523-01 10 µg

Recombinant Human SIRPB1/CD172b Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human SIRPB1/CD172b Protein (His Tag)
PKSH033523-02 50 µg

Recombinant Human SIRPB1/CD172b Protein (His Tag)

Sign In for Pricing
View Details
Wilm's Tumor 1 (WT1) (Wilm's Tumor & Mesothelial Marker), 1mg/mL
BNUM1665-50 1x 50 µL

Wilm's Tumor 1 (WT1) (Wilm's Tumor & Mesothelial Marker), 1mg/mL

Sign In for Pricing
View Details
Human ILKAP, N-His, C-His Tag
HA210744-01 20 µg

Human ILKAP, N-His, C-His Tag

Sign In for Pricing
View Details
Human ILKAP, N-His, C-His Tag
HA210744-02 50 µg

Human ILKAP, N-His, C-His Tag

Sign In for Pricing
View Details