Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGB Rabbit pAb (APR20569N)

Product Specifications

Background

The protein encoded by this gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FGB Rabbit pAb (APR20569N) .

Synonyms

FGB; HEL-S-78p

Gene ID

2244

UniProt

P02675

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 55kDa Observed MW: 56KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2244

Uniprot URL

https://www.uniprot.org/uniprot/P02675

AA Sequence

LENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFPQQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KDM2B, Control Peptide (Lysine-specific Demethylase 2B, JmjC Domain-containing Histone Demethylation Protein 1B, [Histone-H3]-lysine-36 Demethylase 1B, F-box/LRR-repeat Protein 10, F-box and Leucine-rich Repeat Protein 10, F-box Protein FBL10, Protein JEMMA, Jumonji Domain-containing EMSY-interactor Methyltransferase Motif Protein, CXXC-type Zinc Finger Protein 2, Protein-containing CXXC Domain 2, CXXC2, FBL10, JHDM1B, PCCX2, JHDM1b, FBXL10)
147923 100 µg

KDM2B, Control Peptide (Lysine-specific Demethylase 2B, JmjC Domain-containing Histone Demethylation Protein 1B, [Histone-H3]-lysine-36 Demethylase 1B, F-box/LRR-repeat Protein 10, F-box and Leucine-rich Repeat Protein 10, F-box Protein FBL10, Protein JEMMA, Jumonji Domain-containing EMSY-interactor Methyltransferase Motif Protein, CXXC-type Zinc Finger Protein 2, Protein-containing CXXC Domain 2, CXXC2, FBL10, JHDM1B, PCCX2, JHDM1b, FBXL10)

Sign In for Pricing
View Details
WNT16, CT (WNT16, Protein Wnt-16) (MaxLight 650) discontinued
043888-ML650 100 µL

WNT16, CT (WNT16, Protein Wnt-16) (MaxLight 650) discontinued

Sign In for Pricing
View Details
GUSB, CT (GUSB, Beta-glucuronidase, Beta-G1) (MaxLight 405) discontinued
036391-ML405 100 µL

GUSB, CT (GUSB, Beta-glucuronidase, Beta-G1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal MTMR2 Antibody (OTI2D2) [Alexa Fluor 488]
NBP2-72809AF488 0.1 mL

Mouse Monoclonal MTMR2 Antibody (OTI2D2) [Alexa Fluor 488]

Sign In for Pricing
View Details
RGD1565672 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6472604 1.0 µg DNA

RGD1565672 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Dulbecco's Modified Eagle Medium (DMEM) for MDA-MB-231 Cells
abx703251 500 mL

Dulbecco's Modified Eagle Medium (DMEM) for MDA-MB-231 Cells

Sign In for Pricing
View Details