Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGB Rabbit pAb (APR20569N)

Product Specifications

Background

The protein encoded by this gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FGB Rabbit pAb (APR20569N) .

Synonyms

FGB; HEL-S-78p

Gene ID

2244

UniProt

P02675

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 55kDa Observed MW: 56KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2244

Uniprot URL

https://www.uniprot.org/uniprot/P02675

AA Sequence

LENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFPQQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1252 Protein Vector (Mouse) (pPB-N-His)
PV208707 500 ng

Olfr1252 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Lentiviral human MN1 shRNA (UAS) - Lentiviral human MN1 shRNA (UAS) (25)
GTR15118145 1 Vial

Lentiviral human MN1 shRNA (UAS) - Lentiviral human MN1 shRNA (UAS) (25)

Sign In for Pricing
View Details
Pex10 3'UTR GFP Stable Cell Line
TU166204 1.0 mL

Pex10 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Guinea pig coagulation factor XIII (FXIII) ELISA Kit
MBS264457-01 48 Well

Guinea pig coagulation factor XIII (FXIII) ELISA Kit

Sign In for Pricing
View Details
Guinea pig coagulation factor XIII (FXIII) ELISA Kit
MBS264457-02 96 Well

Guinea pig coagulation factor XIII (FXIII) ELISA Kit

Sign In for Pricing
View Details
Guinea pig coagulation factor XIII (FXIII) ELISA Kit
MBS264457-03 5x 96 Well

Guinea pig coagulation factor XIII (FXIII) ELISA Kit

Sign In for Pricing
View Details