Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-DPB1 Rabbit pAb (APR20558N)

Product Specifications

Background

HLA-DPB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta chain (DPB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages) . The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DP molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to 4 different molecules.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HLA-DPB1 Rabbit pAb (APR20558N) .

Synonyms

DPB1; HLA-DP; HLA-DP1B; HLA-DPB; HLA-DPB1; major histocompatibility complex; class II; DP beta 1

Gene ID

3115

UniProt

P04440

Cellular Locus

Cell membrane, Endoplasmic reticulum membrane, Endosome membrane, Golgi apparatus, Lysosome membrane, Single-pass type I membrane protein, trans-Golgi network membrane

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 29kDa Observed MW: 29kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3115

Uniprot URL

https://www.uniprot.org/uniprot/P04440

AA Sequence

RATPENYLFQGRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSARSK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OR10S1 Knockout HEK293T cell line
GTR15423026 1 Vial

Human OR10S1 Knockout HEK293T cell line

Sign In for Pricing
View Details
SDF2 AAV Vector (Rat) (CMV)
43245106 1 µg

SDF2 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Lentiviral mouse Id3 shRNA (UAS) - Lentiviral mouse Id3 shRNA (UAS) (100)
GTR15246018 1 Vial

Lentiviral mouse Id3 shRNA (UAS) - Lentiviral mouse Id3 shRNA (UAS) (100)

Sign In for Pricing
View Details
Human Phosphopantothenoylcysteine Synthetase (PPCS) ELISA Kit
MBS9313057-01 48 Well

Human Phosphopantothenoylcysteine Synthetase (PPCS) ELISA Kit

Sign In for Pricing
View Details
Human Phosphopantothenoylcysteine Synthetase (PPCS) ELISA Kit
MBS9313057-02 96 Well

Human Phosphopantothenoylcysteine Synthetase (PPCS) ELISA Kit

Sign In for Pricing
View Details
Human Phosphopantothenoylcysteine Synthetase (PPCS) ELISA Kit
MBS9313057-03 5x 96 Well

Human Phosphopantothenoylcysteine Synthetase (PPCS) ELISA Kit

Sign In for Pricing
View Details