Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Glypican 3 (GPC3) Rabbit pAb (APR20549N)

Product Specifications

Background

Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. The protein encoded by this gene can bind to and inhibit the dipeptidyl peptidase activity of CD26, and it can induce apoptosis in certain cell types. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome, also known as Simpson dysmorphia syndrome. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Glypican 3 (GPC3) Rabbit pAb (APR20549N) .

Synonyms

GPC3; DGSX; GTR2-2; MXR7; OCI-5; SDYS; SGB; SGBS; SGBS1; glypican-3

Gene ID

2719

UniProt

P51654

Cellular Locus

Cell membrane, Extracellular side, GPI-anchor, Lipid-anchor, Secreted, extracellular space

Applications

IHC (Homo sapiens, Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 59kDa/65kDa/68kDa Observed MW: 66kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2719

Uniprot URL

https://www.uniprot.org/uniprot/P51654

AA Sequence

VEIDKYWREYILSLEELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVLKVAHVEHEETLSSRRRELIQKLKSFISFYSALPGYICSHSPVAENDTLCWNGQELVERYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEIS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-Linked Anti-Single Ig Il1 Related Receptor (SIGIRR)
FY-AB43218-01 1 mL

Biotin-Linked Anti-Single Ig Il1 Related Receptor (SIGIRR)

Sign In for Pricing
View Details
Biotin-Linked Anti-Single Ig Il1 Related Receptor (SIGIRR)
FY-AB43218-02 100 µL

Biotin-Linked Anti-Single Ig Il1 Related Receptor (SIGIRR)

Sign In for Pricing
View Details
Biotin-Linked Anti-Single Ig Il1 Related Receptor (SIGIRR)
FY-AB43218-03 200 µL

Biotin-Linked Anti-Single Ig Il1 Related Receptor (SIGIRR)

Sign In for Pricing
View Details
Rabbit anti-Zea mays (Maize) GAPC2 Polyclonal Antibody
MBS7147481 Inquire

Rabbit anti-Zea mays (Maize) GAPC2 Polyclonal Antibody

Sign In for Pricing
View Details
EGFR-IN-86
MBS5820523 Inquire

EGFR-IN-86

Sign In for Pricing
View Details
CD14 Antibody, HRP conjugated
A42511-50UG 50 µg

CD14 Antibody, HRP conjugated

Sign In for Pricing
View Details