Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP17A1 Rabbit pAb (APR20530N)

Product Specifications

Background

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. It has both 17alpha-hydroxylase and 17,20-lyase activities and is a key enzyme in the steroidogenic pathway that produces progestins, mineralocorticoids, glucocorticoids, androgens, and estrogens. Mutations in this gene are associated with isolated steroid-17 alpha-hydroxylase deficiency, 17-alpha-hydroxylase/17,20-lyase deficiency, pseudohermaphroditism, and adrenal hyperplasia.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CYP17A1 Rabbit pAb (APR20530N) .

Synonyms

CYP17A1; CPT7; CYP17; P450C17; S17AH; 20 lyase

Gene ID

1586

UniProt

P05093

Cellular Locus

Membrane

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 57kDa Observed MW: 57kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1586

Uniprot URL

https://www.uniprot.org/uniprot/P05093

AA Sequence

LSKDSLVDLVPWLKIFPNKTLEKLKSHVKIRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNPAGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEGIPKVVFLIDSFKVKIKVRQAWREAQAEGST

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lta4h sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3829406 1.0 µg DNA

Lta4h sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
TRAP220 (Phospho Thr1457) Polyclonal Antibody
BT-AP01747-01 20 µL

TRAP220 (Phospho Thr1457) Polyclonal Antibody

Sign In for Pricing
View Details
TRAP220 (Phospho Thr1457) Polyclonal Antibody
BT-AP01747-02 50 µL

TRAP220 (Phospho Thr1457) Polyclonal Antibody

Sign In for Pricing
View Details
TRAP220 (Phospho Thr1457) Polyclonal Antibody
BT-AP01747-03 100 µL

TRAP220 (Phospho Thr1457) Polyclonal Antibody

Sign In for Pricing
View Details
TAF II p100 Rabbit Polyclonal Antibody
E53P05969 100 µL

TAF II p100 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Clostridium Phytofermentans uvrC Protein (aa 1-628)
VAng-Lsx01491-inquire Inquire

Recombinant Clostridium Phytofermentans uvrC Protein (aa 1-628)

Sign In for Pricing
View Details