Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD74 Rabbit pAb (APR20520N)

Product Specifications

Background

The protein encoded by this gene associates with class II major histocompatibility complex (MHC) and is an important chaperone that regulates antigen presentation for immune response. It also serves as cell surface receptor for the cytokine macrophage migration inhibitory factor (MIF) which, when bound to the encoded protein, initiates survival pathways and cell proliferation. This protein also interacts with amyloid precursor protein (APP) and suppresses the production of amyloid beta (Abeta) . Multiple alternatively spliced transcript variants encoding different isoforms have been identified.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD74 Rabbit pAb (APR20511N8) .

Synonyms

CD74; DHLAG; HLADG; II; Ia-GAMMA

Gene ID

972

UniProt

P04233

Cellular Locus

Cell membrane, Endoplasmic reticulum membrane, Endosome, Golgi apparatus, Lysosome, Single-pass type II membrane protein, trans-Golgi network

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 18kDa/26kDa/33kDa Observed MW: 30-40kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=972

Uniprot URL

https://www.uniprot.org/uniprot/P04233

AA Sequence

QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATF2 (Cyclic AMP-dependent Transcription Factor ATF-2, cAMP-dependent Transcription Factor ATF-2, Activating Transcription Factor 2, cAMP Response Element-binding Protein CRE-BP1, HB16, Cyclic AMP-responsive Element-binding Protein 2, cAMP-responsive Element-binding Protein 2, CREB-2, CREB2, CREBP1) discontinued
A0855-43X 50 µg

ATF2 (Cyclic AMP-dependent Transcription Factor ATF-2, cAMP-dependent Transcription Factor ATF-2, Activating Transcription Factor 2, cAMP Response Element-binding Protein CRE-BP1, HB16, Cyclic AMP-responsive Element-binding Protein 2, cAMP-responsive Element-binding Protein 2, CREB-2, CREB2, CREBP1) discontinued

Sign In for Pricing
View Details
Presenilin 2 (PSEN2) Human Over-expression Lysate
orb1347665 100 µg

Presenilin 2 (PSEN2) Human Over-expression Lysate

Sign In for Pricing
View Details
LplT Antibody
orb820662 2 mg

LplT Antibody

Sign In for Pricing
View Details
Lentiviral human APOC1 shRNA (UAS) - Lentiviral human APOC1 shRNA (UAS, GFP) (25)
GTR15087380 1 Vial

Lentiviral human APOC1 shRNA (UAS) - Lentiviral human APOC1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Rabbit Polyclonal RNF144A Antibody
NBP2-13238-25ul 25 µL

Rabbit Polyclonal RNF144A Antibody

Sign In for Pricing
View Details
Batf3 Mouse shRNA Plasmid (Locus ID 381319)
TL516496 1 Kit

Batf3 Mouse shRNA Plasmid (Locus ID 381319)

Sign In for Pricing
View Details