Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MESDC2 Rabbit pAb (APR20494N)

Product Specifications

Background

Chaperone specifically assisting the folding of beta-propeller/EGF modules within the family of low-density lipoprotein receptors (LDLRs. Acts as a modulator of the Wnt pathway through chaperoning the coreceptors of the canonical Wnt pathway, LRP5 and LRP6, to the plasma membrane. Essential for specification of embryonic polarity and mesoderm induction. Plays an essential role in neuromuscular junction (NMJ formation by promoting cell-surface expression of LRP4 (By similarity. May regulate phagocytosis of apoptotic retinal pigment epithelium (RPE cells (By similarity.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MESDC2 Rabbit pAb (APR20494N) .

Synonyms

MESDC2; BOCA; MESD

Gene ID

23184

UniProt

Q14696

Cellular Locus

Endoplasmic reticulum

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 26kDa Observed MW: 26kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=23184

Uniprot URL

https://www.uniprot.org/uniprot/Q14696

AA Sequence

MAASRWARKAVVLLCASDLLLLLLLLPPPGSCAAEGSPGTPDESTPPPRKKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPVDFSKIDPSKPESILKMTKKGKTLMMFVTVSGSPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVGQDRCADVTLEGQVYPGKGGGSKEKNKTKQDKGKKKKEGDLKSRSSKEENRAGNKREDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cell division cycle-associated protein 2 (CDCA2) ELISA Kit
abx505869 96 Tests

Mouse Cell division cycle-associated protein 2 (CDCA2) ELISA Kit

Sign In for Pricing
View Details
Anti-TIGD1 Antibody Picoband®, PE Conjugate
A17411-1-PE 100 µg/Vial

Anti-TIGD1 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
EF-Ts (m) : 293T Lysate
sc-119940 100 µg - 200 µL

EF-Ts (m) : 293T Lysate

Sign In for Pricing
View Details
Mouse Protein ACN9 homolog, mitochondrial (ACN9) ELISA Kit
MBS284465-01 48 Tests

Mouse Protein ACN9 homolog, mitochondrial (ACN9) ELISA Kit

Sign In for Pricing
View Details
Mouse Protein ACN9 homolog, mitochondrial (ACN9) ELISA Kit
MBS284465-02 96 Tests

Mouse Protein ACN9 homolog, mitochondrial (ACN9) ELISA Kit

Sign In for Pricing
View Details
Mouse Protein ACN9 homolog, mitochondrial (ACN9) ELISA Kit
MBS284465-03 5x 96 Tests

Mouse Protein ACN9 homolog, mitochondrial (ACN9) ELISA Kit

Sign In for Pricing
View Details