Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD146/MCAM Rabbit pAb (APR20489N)

Product Specifications

Background

Plays a role in cell adhesion, and in cohesion of the endothelial monolayer at intercellular junctions in vascular tissue. Its expression may allow melanoma cells to interact with cellular elements of the vascular system, thereby enhancing hematogeneous tumor spread. Could be an adhesion molecule active in neural crest cells during embryonic development. Acts as surface receptor that triggers tyrosine phosphorylation of FYN and PTK2/FAK1, and a transient increase in the intracellular calcium concentration.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD146/MCAM Rabbit pAb (APR20489N) .

Synonyms

MCAM; CD146; MUC18

Gene ID

4162

UniProt

P43121

Cellular Locus

Membrane, Single-pass type I membrane protein

Applications

IHC (Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 57kDa/71kDa Observed MW: 120KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4162

Uniprot URL

https://www.uniprot.org/uniprot/P43121

AA Sequence

VLNLSCEASGHPRPTISWNVNGTASEQDQDPQRVLSTLNVLVTPELLETGVECTASNDLGKNTSILFLELVNLTTLTPDSNTTTGLSTSTASPHTRANSTSTERKLPEPESRGVVIVAVIVCILVLAVLGAVLYFLYKKGKLPCRRSGKQEITLPPSRKSELVVEVKSDKLPEEMGLLQGSSGDKRAPGDQGEKYIDLRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal EHHADH Antibody (OTI2C4) [PerCP]
NBP2-70625PCP 0.1 mL

Mouse Monoclonal EHHADH Antibody (OTI2C4) [PerCP]

Sign In for Pricing
View Details
2,2,2-trifluoroethyl 4-chlorobenzenesulfonate
sc-343314 1 g

2,2,2-trifluoroethyl 4-chlorobenzenesulfonate

Sign In for Pricing
View Details
VPS26 Peptide
DF13267-BP 1 mg

VPS26 Peptide

Sign In for Pricing
View Details
ETK Antibody (Phospho-Tyr40) : Biotin (OAAF07470-Biotin)
OAAF07470-100UG-Biotin 100 µg

ETK Antibody (Phospho-Tyr40) : Biotin (OAAF07470-Biotin)

Sign In for Pricing
View Details
Guinea pig Relaxin (RLN) ELISA Kit
MBS265065-01 48 Well

Guinea pig Relaxin (RLN) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Relaxin (RLN) ELISA Kit
MBS265065-02 96 Well

Guinea pig Relaxin (RLN) ELISA Kit

Sign In for Pricing
View Details