Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM9 Rabbit pAb (APR20459N)

Product Specifications

Background

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Its function has not been identified. Alternate splicing of this gene generates two transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TRIM9 Rabbit pAb (APR20459N) .

Synonyms

TRIM9; RNF91; SPRING

Gene ID

114088

UniProt

Q9C026

Cellular Locus

Cell junction, Cell projection, Cytoplasm, Cytoplasmic vesicle, cytoskeleton, dendrite, secretory vesicle, synapse, synaptic vesicle

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 61kDa/79kDa/89kDa Observed MW: 65kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=114088

Uniprot URL

https://www.uniprot.org/uniprot/Q9C026

AA Sequence

MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CRK6 Polyclonal Antibody
MBS9008120 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CRK6 Polyclonal Antibody

Sign In for Pricing
View Details
Rat CYP2C9 (Cytochrome P450 2C9) ELISA Kit
EK247460 96 Well

Rat CYP2C9 (Cytochrome P450 2C9) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Serpin F1/PEDF (C-6His)
C538-10ug 10 µg

Recombinant Human Serpin F1/PEDF (C-6His)

Sign In for Pricing
View Details
SNX12 Rabbit Polyclonal Antibody
orb556361 100 µL

SNX12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SFTPC, CT (SFTPC, SFTP2, Pulmonary surfactant-associated protein C, Pulmonary surfactant-associated proteolipid SPL(Val), SP5) (MaxLight 650)
MBS6346776-01 0.1 mL

SFTPC, CT (SFTPC, SFTP2, Pulmonary surfactant-associated protein C, Pulmonary surfactant-associated proteolipid SPL(Val), SP5) (MaxLight 650)

Sign In for Pricing
View Details
SFTPC, CT (SFTPC, SFTP2, Pulmonary surfactant-associated protein C, Pulmonary surfactant-associated proteolipid SPL(Val), SP5) (MaxLight 650)
MBS6346776-02 5x 0.1 mL

SFTPC, CT (SFTPC, SFTP2, Pulmonary surfactant-associated protein C, Pulmonary surfactant-associated proteolipid SPL(Val), SP5) (MaxLight 650)

Sign In for Pricing
View Details