Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM9 Rabbit pAb (APR20459N)

Product Specifications

Background

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Its function has not been identified. Alternate splicing of this gene generates two transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TRIM9 Rabbit pAb (APR20459N) .

Synonyms

TRIM9; RNF91; SPRING

Gene ID

114088

UniProt

Q9C026

Cellular Locus

Cell junction, Cell projection, Cytoplasm, Cytoplasmic vesicle, cytoskeleton, dendrite, secretory vesicle, synapse, synaptic vesicle

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 61kDa/79kDa/89kDa Observed MW: 65kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=114088

Uniprot URL

https://www.uniprot.org/uniprot/Q9C026

AA Sequence

MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IPO13 antibody
STJ118912 100 µl

Anti-IPO13 antibody

Sign In for Pricing
View Details
Mouse Kidney And Brain Protein (KIBRA) Antibody Pair Kit (with Standard)
MBS2104323-01 5x 96 Tests

Mouse Kidney And Brain Protein (KIBRA) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Kidney And Brain Protein (KIBRA) Antibody Pair Kit (with Standard)
MBS2104323-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse Kidney And Brain Protein (KIBRA) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Kidney And Brain Protein (KIBRA) Antibody Pair Kit (with Standard)
MBS2104323-03 10x 96 Tests

Mouse Kidney And Brain Protein (KIBRA) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Kidney And Brain Protein (KIBRA) Antibody Pair Kit (with Standard)
MBS2104323-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Mouse Kidney And Brain Protein (KIBRA) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
ORAI1, CT (Transmembrane Protein 142A, TMEM142A, Calcium Release-Activated Calcium Channel Protein 1) (MaxLight 750) discontinued
O7044-03-ML750 100 µL

ORAI1, CT (Transmembrane Protein 142A, TMEM142A, Calcium Release-Activated Calcium Channel Protein 1) (MaxLight 750) discontinued

Sign In for Pricing
View Details