Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLJ12529 Rabbit pAb (APR20443N)

Product Specifications

Background

Cleavage factor Im (CFIm) is one of six factors necessary for correct cleavage and polyadenylation of pre-mRNAs. CFIm is composed of three different subunits of 25, 59, and 68 kDa, and it functions as a heterotetramer, with a dimer of the 25 kDa subunit binding to two of the 59 or 68 kDa subunits. The protein encoded by this gene represents the 59 kDa subunit, which can interact with the splicing factor U2 snRNP Auxiliary Factor (U2AF) 65 to link the splicing and polyadenylation complexes.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FLJ12529 Rabbit pAb (APR20443N) .

Synonyms

CPSF7; CFIm59; FLJ12529

Gene ID

79869

UniProt

Q8N684

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 51kDa/52kDa/56kDa Observed MW: 60kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=79869

Uniprot URL

https://www.uniprot.org/uniprot/Q8N684

AA Sequence

LIDIYADEEFNQDPEFNNTDQIDLYDDVLTATSQPSDDRSSSTEPPPPVRQEPSPKPNNKTPAILYTYSGLRNRRAAVYVGSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRANGQSKGYAEVVVASENSVHKLLELLPGKVLNGEKVDVRPATRQNLSQFEAQARKRECVRVPRGGIPPRAHSRDSSDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ERFE Protein, N-His
MBS1587568-01 0.1 mg

Recombinant Human ERFE Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ERFE Protein, N-His
MBS1587568-02 1 mg

Recombinant Human ERFE Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ERFE Protein, N-His
MBS1587568-03 5x 1 mg

Recombinant Human ERFE Protein, N-His

Sign In for Pricing
View Details
RSPH9 siRNA (Human)
MBS8233174-01 15 nmol

RSPH9 siRNA (Human)

Sign In for Pricing
View Details
RSPH9 siRNA (Human)
MBS8233174-02 30 nmol

RSPH9 siRNA (Human)

Sign In for Pricing
View Details
RSPH9 siRNA (Human)
MBS8233174-03 5x 30 nmol

RSPH9 siRNA (Human)

Sign In for Pricing
View Details