Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMKN Rabbit pAb (APR20433N)

Product Specifications

Background

This gene is upregulated in inflammatory diseases, and it was first observed as expressed in the differentiated layers of skin. The most interesting aspect of this gene is the differential use of promoters and terminators to generate isoforms with unique cellular distributions and domain components. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DMKN Rabbit pAb (APR20433N) .

Synonyms

DMKN; UNQ729; ZD52F10; dermokine

Gene ID

93099

UniProt

Q6E0U4

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 9kDa/14-20kDa/35-47kDa Observed MW: 47kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=93099

Uniprot URL

https://www.uniprot.org/uniprot/Q6E0U4

AA Sequence

WEDFKQNTPFLNWKAIIEGADASSLQKRAGRADQPGAGWQEVAAVTSKNYNYNQHAYPTAYGGKYSVKTPAKGGVSPSSSASRVQPGLLQWVKFW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CD269/TNFRSF17/BCMA Antibody (J22.9-xi), APC
HX959337-01 1 Each

Anti-Human CD269/TNFRSF17/BCMA Antibody (J22.9-xi), APC

Sign In for Pricing
View Details
Anti-Human CD269/TNFRSF17/BCMA Antibody (J22.9-xi), APC
HX959337-02 100 Tests

Anti-Human CD269/TNFRSF17/BCMA Antibody (J22.9-xi), APC

Sign In for Pricing
View Details
ETFA (Electron Transfer Flavoprotein Subunit alpha, Mitochondrial, Alpha-ETF) (HRP)
MBS6152390-01 0.1 mL

ETFA (Electron Transfer Flavoprotein Subunit alpha, Mitochondrial, Alpha-ETF) (HRP)

Sign In for Pricing
View Details
ETFA (Electron Transfer Flavoprotein Subunit alpha, Mitochondrial, Alpha-ETF) (HRP)
MBS6152390-02 5x 0.1 mL

ETFA (Electron Transfer Flavoprotein Subunit alpha, Mitochondrial, Alpha-ETF) (HRP)

Sign In for Pricing
View Details
Lentiviral mouse Ahsa2 shRNA (UAS) - Lentiviral mouseAhsa2 shRNA (UAS, GFP) (25)
GTR15228548 1 Vial

Lentiviral mouse Ahsa2 shRNA (UAS) - Lentiviral mouseAhsa2 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
USP26 Double Nickase Plasmid (m2)
sc-429924-NIC-2 20 µg

USP26 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details