Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A27 Rabbit pAb (APR20397N)

Product Specifications

Background

Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP) . UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. Transcripts of this gene are only detected in brain tissue and are specifically modulated by various environmental conditions. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SLC25A27 Rabbit pAb (APR20397N) .

Synonyms

SLC25A27; UCP4

Gene ID

9481

UniProt

O95847

Cellular Locus

Mitochondrion inner membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 27kDa/36kDa Observed MW: 36kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9481

Uniprot URL

https://www.uniprot.org/uniprot/O95847

AA Sequence

MSVPEEEERLLPLTQRWPRASKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALARLGDGARESAPYRGMVRTALGIIEEEGFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKSEDEHYPLWKSVIGGMMAGVIGQFLANPTDLVKVQMQMEGKRKLEGKPLRFRGVHHAFAKILAEGGIRGLWAGWVPNIQRAALVNMGDLTTYDTVKHYLVLNTPLEDNIMTHGLSSDLVGSHKAIQ

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

WRAP53 (WD40 Repeat-containing Protein Encoding RNA Antisense to p53, Telomerase Cajal Body Protein 1, TCAB1, WD Repeat-containing Protein 79, WDR79, DKCB3) (MaxLight 550)
MBS6398542-01 0.1 mL

WRAP53 (WD40 Repeat-containing Protein Encoding RNA Antisense to p53, Telomerase Cajal Body Protein 1, TCAB1, WD Repeat-containing Protein 79, WDR79, DKCB3) (MaxLight 550)

Ask
View Details
WRAP53 (WD40 Repeat-containing Protein Encoding RNA Antisense to p53, Telomerase Cajal Body Protein 1, TCAB1, WD Repeat-containing Protein 79, WDR79, DKCB3) (MaxLight 550)
MBS6398542-02 5x 0.1 mL

WRAP53 (WD40 Repeat-containing Protein Encoding RNA Antisense to p53, Telomerase Cajal Body Protein 1, TCAB1, WD Repeat-containing Protein 79, WDR79, DKCB3) (MaxLight 550)

Ask
View Details
Biotin-Linked Polyclonal Antibody to Cytoglobin (CYGB)
MBS2094507-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Cytoglobin (CYGB)

Ask
View Details
Biotin-Linked Polyclonal Antibody to Cytoglobin (CYGB)
MBS2094507-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Cytoglobin (CYGB)

Ask
View Details
Biotin-Linked Polyclonal Antibody to Cytoglobin (CYGB)
MBS2094507-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Cytoglobin (CYGB)

Ask
View Details
Biotin-Linked Polyclonal Antibody to Cytoglobin (CYGB)
MBS2094507-04 1 mL

Biotin-Linked Polyclonal Antibody to Cytoglobin (CYGB)

Ask
View Details