Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP3B2 Rabbit pAb (APR20375N)

Product Specifications

Background

Adaptor protein complex 3 (AP-3 complex) is a heterotrimeric protein complex involved in the formation of clathrin-coated synaptic vesicles. The protein encoded by this gene represents the beta subunit of the neuron-specific AP-3 complex and was first identified as the target antigen in human paraneoplastic neurologic disorders. The encoded subunit binds clathrin and is phosphorylated by a casein kinase-like protein, which mediates synaptic vesicle coat assembly. Defects in this gene are a cause of early-onset epileptic encephalopathy.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality AP3B2 Rabbit pAb (APR20375N) .

Synonyms

AP3B2; EIEE48; NAPTB

Gene ID

8120

UniProt

Q13367

Cellular Locus

Cytoplasmic side, Cytoplasmic vesicle, Golgi apparatus, Peripheral membrane protein, clathrin-coated vesicle membrane

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 15kDa/115kDa/119kDa/121kDa Observed MW: 140kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8120

Uniprot URL

https://www.uniprot.org/uniprot/Q13367

AA Sequence

AADLEGLTLTDSTLVPSLLSPVSGVGRQELLHRVAGEGLAVDYTFSRQPFSGDPHMVSVHIHFSNSSDTPIKGLHVGTPKLPAGISIQEFPEIESLAPGESATAVMGINFCDSTQAANFQLCTQTRQFYVSIQPPVGELMAPVFMSENEFKKEQGKLMGMNEITEKLMLPDTCRSDHIVVQKVTATANLGRVPCGTSDEYRFAGRTLTGGSLVLLTLDARPAGAAQLTVNSEKMVIGTMLVKDVIQALTQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5- (2-Chloro-acetylamino) -isophthalic acid diethyl ester
sc-356943A 5 g

5- (2-Chloro-acetylamino) -isophthalic acid diethyl ester

Sign In for Pricing
View Details
Glucocorticoid Receptor β (GRb) Rabbit ELISA Kit
D8347 96 Tests

Glucocorticoid Receptor β (GRb) Rabbit ELISA Kit

Sign In for Pricing
View Details
Mouse RHOH shRNA Plasmid
abx978303-01 150 µg

Mouse RHOH shRNA Plasmid

Sign In for Pricing
View Details
Mouse RHOH shRNA Plasmid
abx978303-02 300 µg

Mouse RHOH shRNA Plasmid

Sign In for Pricing
View Details
Recombinant Bovine Cytosolic purine 5'-nucleotidase (NT5C2) , partial
MBS1165141 Inquire

Recombinant Bovine Cytosolic purine 5'-nucleotidase (NT5C2) , partial

Sign In for Pricing
View Details
Recombinant Mycobacterium Bovis prcA Protein (aa 1-248) (strain BCG / Pasteur 1173P2)
VAng-Yyj3519-500gEcoli 500 µg (E. coli)

Recombinant Mycobacterium Bovis prcA Protein (aa 1-248) (strain BCG / Pasteur 1173P2)

Sign In for Pricing
View Details