Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRIK4 Rabbit pAb (APR20367N)

Product Specifications

Background

This gene encodes a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. The protein encoded by this gene forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GRIK4 Rabbit pAb (APR20367N) .

Synonyms

GRIK4; EAA1; GRIK; GluK4; KA1; kainate 4

Gene ID

2900

UniProt

Q16099

Cellular Locus

Cell junction, Cell membrane, Multi-pass membrane protein, postsynaptic cell membrane, synapse

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 107kDa Observed MW: 100kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2900

Uniprot URL

https://www.uniprot.org/uniprot/Q16099

AA Sequence

SPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLGKAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFKVAPEEFVKFQFQRFTTLNLHPSNTDISVAVAGILNFFNCTTACLICAKAECLLNLEKLLRQFLISKDTLSVRMLDDTRDPTPLLKEIRDDKTATIIIHAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZWILCH Protein Vector (Mouse) (pPM-C-HA)
51993024 500 ng

ZWILCH Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Phka2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6727708 1.0 µg DNA

Phka2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Recombinant Anti-ASAM Antibody, Rabbit Monoclonal
MBS8111738-01 0.1 mL

Recombinant Anti-ASAM Antibody, Rabbit Monoclonal

Sign In for Pricing
View Details
Recombinant Anti-ASAM Antibody, Rabbit Monoclonal
MBS8111738-02 5x 0.1 mL

Recombinant Anti-ASAM Antibody, Rabbit Monoclonal

Sign In for Pricing
View Details
TRIP4 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
47859124 3x 1.0µg DNA

TRIP4 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
1-Benzylglycerol, 95%
B1077-98A 2 g

1-Benzylglycerol, 95%

Sign In for Pricing
View Details