Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCB10 Rabbit pAb (APR20355N)

Product Specifications

Background

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White) . This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The function of this mitochondrial protein is unknown.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ABCB10 Rabbit pAb (APR20347N7) .

Synonyms

ABCB10; EST20237; M-ABC2; MTABC2

Gene ID

23456

UniProt

Q9NRK6

Cellular Locus

Mitochondrion inner membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 79kDa Observed MW: 80kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=23456

Uniprot URL

https://www.uniprot.org/uniprot/Q9NRK6

AA Sequence

AIRVYLMQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTENLSDGLRAGAQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Heat Shock Protein 75 kDa, Mitochondrial (TRAP1) ELISA Kit
MBS9946391-01 48 Well

Hamster Heat Shock Protein 75 kDa, Mitochondrial (TRAP1) ELISA Kit

Sign In for Pricing
View Details
Hamster Heat Shock Protein 75 kDa, Mitochondrial (TRAP1) ELISA Kit
MBS9946391-02 96 Well

Hamster Heat Shock Protein 75 kDa, Mitochondrial (TRAP1) ELISA Kit

Sign In for Pricing
View Details
Hamster Heat Shock Protein 75 kDa, Mitochondrial (TRAP1) ELISA Kit
MBS9946391-03 5x 96 Well

Hamster Heat Shock Protein 75 kDa, Mitochondrial (TRAP1) ELISA Kit

Sign In for Pricing
View Details
Hamster Heat Shock Protein 75 kDa, Mitochondrial (TRAP1) ELISA Kit
MBS9946391-04 10x 96 Well

Hamster Heat Shock Protein 75 kDa, Mitochondrial (TRAP1) ELISA Kit

Sign In for Pricing
View Details
RGD1310036 3'UTR GFP Stable Cell Line
TU267866 1.0 mL

RGD1310036 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
MED24 CRISPRa sgRNA lentivector (set of three targets)(Human)
28308121 3x 1.0µg DNA

MED24 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details