Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELMO2 Rabbit pAb (APR20353N)

Product Specifications

Background

The protein encoded by this gene interacts with the dedicator of cyto-kinesis 1 protein. Similarity to a C. elegans protein suggests that this protein may function in phagocytosis of apoptotic cells and in cell migration. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ELMO2 Rabbit pAb (APR20347N5) .

Synonyms

ELMO2; CED-12; CED12; Ced-12A; ELMO-2; VMPI

Gene ID

63916

UniProt

Q96JJ3

Cellular Locus

Cytoplasm, Membrane, cytosol

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 72kDa/82kDa Observed MW: 83kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=63916

Uniprot URL

https://www.uniprot.org/uniprot/Q96JJ3

AA Sequence

SLPNPEYYTLRYADGPQLYITEQTRSDIKNGTILQLAISPSRAARQLMERTQSSNMETRLDAMKELAKLSADVTFATEF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PFKM Antibody
ABD7362 100 µg

PFKM Antibody

Sign In for Pricing
View Details
Human IGFBP3 activation kit by CRISPRa
GA102355 1 Kit

Human IGFBP3 activation kit by CRISPRa

Sign In for Pricing
View Details
ELAV1 Rabbit Polyclonal Antibody
MBS9514370-01 0.05 mL

ELAV1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ELAV1 Rabbit Polyclonal Antibody
MBS9514370-02 0.1 mL

ELAV1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ELAV1 Rabbit Polyclonal Antibody
MBS9514370-03 5x 0.1 mL

ELAV1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRPM4 Protein Lysate (Mouse) with C-HA Tag
48523034 100 µg

TRPM4 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details