Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NTN4 Rabbit pAb (APR20342N)

Product Specifications

Background

This gene encodes a member of the netrin family of proteins, which function in various biological processes including axon guidance, tumorogenesis, and angiogenesis. Netrins are laminin-related proteins that have an N-terminal laminin-type domain, epidermal growth factor-like repeat domain, and a positively charged heparin-binding domain at the C-terminus. The protein encoded by this gene is involved in processes including neurite growth and migration, angiogenesis and mural cell adhesion to endothelial cells. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NTN4 Rabbit pAb (APR20342N) .

Synonyms

NTN4; PRO3091; netrin-4

Gene ID

59277

UniProt

Q9HB63

Cellular Locus

Secreted, basement membrane, extracellular matrix, extracellular space

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 66kDa/67kDa/70kDa Observed MW: 70kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=59277

Uniprot URL

https://www.uniprot.org/uniprot/Q9HB63

AA Sequence

HGKCMCKHNTAGSHCQHCAPLYNDRPWEAADGKTGAPNECRTCKCNGHADTCHFDVNVWEASGNRSGGVCDDCQHNTEGQYCQRCKPGFYRDLRRPFSAPDACKPCSCHPVGSAVLPANSVTFCDPSNGDCPCKPGVAGRRCDRCMVGYWGFGDYGCRPCDCAGSCDPITGDCISSHTDIDWYHEVPDFRPVHNKSEPAWEWEDAQGFSALLHSGKCECKEQTLGNAKAFC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ube2L3 Polyclonal Antibody, APC-Cy7 Conjugated
bs-8350R-APC-Cy7 100 µL

Ube2L3 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Glucocorticoid Receptor (NR3C1) Human Gene Knockout Kit (CRISPR)
KN204878 1 Kit

Glucocorticoid Receptor (NR3C1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) SPBC1D7.01 Polyclonal Antibody
MBS7179813 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) SPBC1D7.01 Polyclonal Antibody

Sign In for Pricing
View Details
RLN3 Recombinant Protein (Human)
RP086883 100 µg

RLN3 Recombinant Protein (Human)

Sign In for Pricing
View Details
TADA3L Antibody - middle region : HRP (ARP31479_P050-HRP)
ARP31479_P050-HRP 100 µL

TADA3L Antibody - middle region : HRP (ARP31479_P050-HRP)

Sign In for Pricing
View Details
GDNF rabbit pAb
ES11350-01 50 µL

GDNF rabbit pAb

Sign In for Pricing
View Details