Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT36 Rabbit pAb (APR20326N)

Product Specifications

Background

The protein encoded by this gene is a member of the keratin gene family. This type I hair keratin is an acidic protein which heterodimerizes with type II keratins to form hair and nails. The type I hair keratins are clustered in a region of chromosome 17q12-q21 and have the same direction of transcription.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KRT36 Rabbit pAb (APR20326N) .

Synonyms

KRT36; HA6; KRTHA6; hHa6

Gene ID

8689

UniProt

O76013

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 47kDa/52kDa Observed MW: 52KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8689

Uniprot URL

https://www.uniprot.org/uniprot/O76013

AA Sequence

GEIATYRHLLEGEDCKLPPQPCATACKPVIRVPSVPPVPCVPSVPCTPAPQVGTQIRTITEEIRDGKVISSREHVQSRPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cryptdin-4 (Mouse)
PDF-4504-S 0.1 mg

Cryptdin-4 (Mouse)

Sign In for Pricing
View Details
Fip1l1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
20565114 3x 1.0 µg

Fip1l1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
ERAP2 Peptide
orb1232018 0.05 mg

ERAP2 Peptide

Sign In for Pricing
View Details
Rabbit anti-Shigella flexneri yeiP Polyclonal Antibody
MBS9000240 Inquire

Rabbit anti-Shigella flexneri yeiP Polyclonal Antibody

Sign In for Pricing
View Details
Mapk8ip1 (NM_053777) Rat Tagged ORF Clone Lentiviral Particle
RR215656L4V 200 µL

Mapk8ip1 (NM_053777) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SHFL (NM_018381) Human Recombinant Protein
TP312344M 100 µg

SHFL (NM_018381) Human Recombinant Protein

Sign In for Pricing
View Details