Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P3H4 Rabbit pAb (APR20321N)

Product Specifications

Background

This nucleolar protein was first characterized because it was an autoantigen in cases on interstitial cystitis. The protein, with a predicted molecular weight of 50 kDa, appears to be localized in the particulate compartment of the interphase nucleolus, with a distribution distinct from that of nucleolar protein B23. During mitosis it is associated with chromosomes.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality P3H4 Rabbit pAb (APR20321N) .

Synonyms

P3H4; LEPREL4; NO55; NOL55; SC65

Gene ID

10609

UniProt

Q92791

Cellular Locus

Chromosome, Nucleus, nucleolus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 50kDa Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10609

Uniprot URL

https://www.uniprot.org/uniprot/Q92791

AA Sequence

FHRARWGLEEEDFQPREEAMLYHNQTAELRELLEFTHMYLQSDDEMELEETEPPLEPEDALSDAEFEGEGDYEEGMYADWWQEPDAKGDEAEAEPEPELA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TEX19 shRNA (UAS) - Lentiviral human TEX19 shRNA (UAS, iRFP) (25)
GTR15085826 1 Vial

Lentiviral human TEX19 shRNA (UAS) - Lentiviral human TEX19 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Duck Nuclear Pore Complex Protein Nup153 (NUP153) ELISA Kit
MBS9905164 Inquire

Duck Nuclear Pore Complex Protein Nup153 (NUP153) ELISA Kit

Sign In for Pricing
View Details
ATP2A2 Protein Lysate (Human) with C-Ha Tag
12684031 100 µg

ATP2A2 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
MATR3 Antibody Blocking Peptide
orb1503834 500 µg

MATR3 Antibody Blocking Peptide

Sign In for Pricing
View Details
MAb to Influenza A H5
MBS310419 Inquire

MAb to Influenza A H5

Sign In for Pricing
View Details
HOXA11 (Homeobox A11, HOX1, HOX1I) (HRP)
247188-HRP 100 µL

HOXA11 (Homeobox A11, HOX1, HOX1I) (HRP)

Sign In for Pricing
View Details