Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP17A1 Rabbit pAb (APR20299N)

Product Specifications

Background

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. It has both 17alpha-hydroxylase and 17,20-lyase activities and is a key enzyme in the steroidogenic pathway that produces progestins, mineralocorticoids, glucocorticoids, androgens, and estrogens. Mutations in this gene are associated with isolated steroid-17 alpha-hydroxylase deficiency, 17-alpha-hydroxylase/17,20-lyase deficiency, pseudohermaphroditism, and adrenal hyperplasia.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CYP17A1 Rabbit pAb (APR20299N) .

Synonyms

CYP17A1; CPT7; CYP17; P450C17; S17AH; 20 lyase

Gene ID

1586

UniProt

P05093

Cellular Locus

Membrane

Applications

IHC (Sus scrofa) WB (Mus musculus)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 57kDa Observed MW: 57kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1586

Uniprot URL

https://www.uniprot.org/uniprot/P05093

AA Sequence

LSKDSLVDLVPWLKIFPNKTLEKLKSHVKIRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNPAGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEGIPKVVFLIDSFKVKIKVRQAWREAQAEGST

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hexokinase 1 (HK1) (NM_033500) Human Tagged ORF Clone
RC216182 10 µg

Hexokinase 1 (HK1) (NM_033500) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal DGKH Antibody
NBP1-85229-25ul 25 µL

Rabbit Polyclonal DGKH Antibody

Sign In for Pricing
View Details
Olfr550 (NM_147104) Mouse Tagged Lenti ORF Clone
MR214892L3 10 µg

Olfr550 (NM_147104) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
STRAP Polyclonal Antibody
ANT-14589-100ug 100 µg

STRAP Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-PIK3R1 antibody
SLM-52216R-01 50 µL

Rabbit Anti-PIK3R1 antibody

Sign In for Pricing
View Details
Rabbit Anti-PIK3R1 antibody
SLM-52216R-02 100 µL

Rabbit Anti-PIK3R1 antibody

Sign In for Pricing
View Details