Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DOK5 Rabbit pAb (APR20295N)

Product Specifications

Background

The protein encoded by this gene is a member of the DOK family of membrane proteins, which are adapter proteins involved in signal transduction. The encoded protein interacts with phosphorylated receptor tyrosine kinases to mediate neurite outgrowth and activation of the MAP kinase pathway. Unlike other DOK family proteins, this protein does not interact with RASGAP. This protein is up-regulated in patients with systemic sclerosis and is associated with fibrosis induced by insulin-like growth factor binding protein 5. Alternative splicing of this gene results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DOK5 Rabbit pAb (APR20295N) .

Synonyms

DOK5; C20orf180; IRS-6; IRS6

Gene ID

55816

UniProt

Q9P104

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 22kDa/35kDa Observed MW: 30kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55816

Uniprot URL

https://www.uniprot.org/uniprot/Q9P104

AA Sequence

LLQSVKNSMLQMKMSERAASLSTMVPLPRSAYWQHITRQHSTGQLYRLQDVSSPLKLHRTETFPAYRSEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIC1 Rabbit pAb
E45R20471N 50 ul

HIC1 Rabbit pAb

Sign In for Pricing
View Details
Human SLC41A2 Knockout HEK293T cell line
GTR15422048 1 Vial

Human SLC41A2 Knockout HEK293T cell line

Sign In for Pricing
View Details
Anp32b (NM_130889) Mouse Tagged ORF Clone
MG203635 10 µg

Anp32b (NM_130889) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ETV4 (ETS Translocation Variant 4, Polyomavirus Enhancer Activator 3 Homolog, Protein PEA3, Adenovirus E1A Enhancer-binding Protein, E1A-F, E1AF) (FITC)
MBS6147091-01 0.1 mL

ETV4 (ETS Translocation Variant 4, Polyomavirus Enhancer Activator 3 Homolog, Protein PEA3, Adenovirus E1A Enhancer-binding Protein, E1A-F, E1AF) (FITC)

Sign In for Pricing
View Details
ETV4 (ETS Translocation Variant 4, Polyomavirus Enhancer Activator 3 Homolog, Protein PEA3, Adenovirus E1A Enhancer-binding Protein, E1A-F, E1AF) (FITC)
MBS6147091-02 5x 0.1 mL

ETV4 (ETS Translocation Variant 4, Polyomavirus Enhancer Activator 3 Homolog, Protein PEA3, Adenovirus E1A Enhancer-binding Protein, E1A-F, E1AF) (FITC)

Sign In for Pricing
View Details
Allatostatin 1 - I-125 Labeled
T-047-14 10 µCi

Allatostatin 1 - I-125 Labeled

Sign In for Pricing
View Details