Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIME1 Rabbit pAb (APR20289N)

Product Specifications

Background

This gene encodes a transmembrane adaptor protein that links the T and B-cell receptor stimulation to downstream signaling pathways via its association with the Src family kinases Lck and Lyn, respectively. Alternative splicing of this gene results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality LIME1 Rabbit pAb (APR20289N) .

Synonyms

LIME1; LIME; dJ583P15.4

Gene ID

54923

UniProt

Q9H400

Cellular Locus

Cell membrane, Single-pass type III membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 20kDa/31kDa Observed MW: 31kDa-35kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=54923

Uniprot URL

https://www.uniprot.org/uniprot/Q9H400

AA Sequence

MGLPVSWAPPALWVLGCCALLLSLWALCTACRRPEDAVAPRKRARRQRARLQGSATAAEASLLRRTHLCSLSKSDTRLHELHRGPRSSRALRPASMDLLRPHWLEVSRDITGPQAAPSAFPHQELPRALPAAAATAGCAGLEATYSNVGLAALPGVSLAASPVVAEYARVQKRKGTHRSPQEPQQGKTEVTPAAQVDVLYSRVCKPKRRDPGPTTDPLDPKGQGAILALAGDLAYQTLPLRALDVDSGPLENVYESIRELGDPAGRSSTCGAGTPPASSCPSLGRGWRPLPASLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IL-33, Tag Free
HA210768-01 20 µg

Mouse IL-33, Tag Free

Sign In for Pricing
View Details
Mouse IL-33, Tag Free
HA210768-02 50 µg

Mouse IL-33, Tag Free

Sign In for Pricing
View Details
Mouse IL-33, Tag Free
HA210768-03 100 µg

Mouse IL-33, Tag Free

Sign In for Pricing
View Details
Mini Sample Mouse SELE (E-selectin) ELISA Kit
E-MSEL-M0014-01 24 Tests

Mini Sample Mouse SELE (E-selectin) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse SELE (E-selectin) ELISA Kit
E-MSEL-M0014-02 48 Tests

Mini Sample Mouse SELE (E-selectin) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse SELE (E-selectin) ELISA Kit
E-MSEL-M0014-03 96 Tests

Mini Sample Mouse SELE (E-selectin) ELISA Kit

Sign In for Pricing
View Details