Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEP27 Rabbit pAb (APR20277N)

Product Specifications

Background

The protein encoded by this gene is a subunit of the augmin complex. The augmin complex plays a role in microtubule attachment to the kinetochore and central spindle formation.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CEP27 Rabbit pAb (APR20277N) .

Synonyms

HAUS2; C15orf25; CEP27; HsT17025

Gene ID

55142

UniProt

Q9NVX0

Cellular Locus

Cytoplasm, centrosome, cytoskeleton, microtubule organizing center, spindle

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 16kDa/23kDa/26kDa Observed MW: 27kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55142

Uniprot URL

https://www.uniprot.org/uniprot/Q9NVX0

AA Sequence

MAAANPWDPASAPNGAGLVLGHFIASGMVNQEMLNMSKKTVSCFVNFTRLQQITNIQAEIYQKNLEIELLKLEKDTADVVHPFFLAQKCHTLQSMNNHLEAVLKEKRSLRQRLLKPMCQENLPIEAVYHRYMVHLLELAVTFIERLETHLETIRNIPHLAANLKKMNQALAKMDILVTETEELAENILKWRKQQNEVSSCIPKILAEESYLYKHDIIMPPLPFTSKVHVQTINAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNBP Rabbit Polyclonal Antibody
TA374913 100 µL

CNBP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phalloidin, CF®430, 50 U
#00054-T 1x 50 U

Phalloidin, CF®430, 50 U

Sign In for Pricing
View Details
MICA Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F5]
TA813288BM 100 µL

MICA Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F5]

Sign In for Pricing
View Details
ATG5 (Autophagy Marker) (rATG5/2553), CF568 conjugate, 0.1mg/mL
BNC683642-500 1x 500 µL

ATG5 (Autophagy Marker) (rATG5/2553), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RGS9 (NM_001081955) Human Over-expression Lysate
LC421179 20 µg

RGS9 (NM_001081955) Human Over-expression Lysate

Sign In for Pricing
View Details
Androst-5-ene-3,11,17-trione, Cyclic 3,17-Bis(1,2-ethanediyl acetal)
TRC-A637940-50MG 50 mg

Androst-5-ene-3,11,17-trione, Cyclic 3,17-Bis(1,2-ethanediyl acetal)

Sign In for Pricing
View Details