Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF4EBP2 Rabbit pAb (APR20262N)

Product Specifications

Background

This gene encodes a member of the eukaryotic translation initiation factor 4E binding protein family. The gene products of this family bind eIF4E and inhibit translation initiation. However, insulin and other growth factors can release this inhibition via a phosphorylation-dependent disruption of their binding to eIF4E. Regulation of protein production through these gene products have been implicated in cell proliferation, cell differentiation and viral infection.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EIF4EBP2 Rabbit pAb (APR20262N) .

Synonyms

EIF4EBP2; 4EBP2; PHASII

Gene ID

1979

UniProt

Q13542

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 12kDa Observed MW: 16kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1979

Uniprot URL

https://www.uniprot.org/uniprot/Q13542

AA Sequence

DRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Spinal Cord Primary Astrocytes
CCEL25 5x 10^5 Cells/Vial

Porcine Spinal Cord Primary Astrocytes

Sign In for Pricing
View Details
Tau, Nitrated (Tyr18) (microtubule-associated protein tau, DDPAC, FLJ31424, FTDP-17, MAPTL, MGC138549, Microtubule-associated protein tau, MSTD, MTBT1, MTBT2, Neurofibrillary tangle protein, Paired helical filament-tau, PHF-tau, PPND, tau, TAU) (MaxLight 750) discontinued
T1030-10D-ML750 100 µL

Tau, Nitrated (Tyr18) (microtubule-associated protein tau, DDPAC, FLJ31424, FTDP-17, MAPTL, MGC138549, Microtubule-associated protein tau, MSTD, MTBT1, MTBT2, Neurofibrillary tangle protein, Paired helical filament-tau, PHF-tau, PPND, tau, TAU) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Nol10 3'UTR Luciferase Stable Cell Line
TU214069 1.0 mL

Nol10 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
LGALS3BP (NM_005567) Human Over-expression Lysate
LH07775V 100 µg

LGALS3BP (NM_005567) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-LIR-7 LILRA2 Antibody
A11081 100 µL

Anti-LIR-7 LILRA2 Antibody

Sign In for Pricing
View Details
RNF11, ID (RNF11, RING finger protein 11) (AP)
MBS6342511-01 0.2 mL

RNF11, ID (RNF11, RING finger protein 11) (AP)

Sign In for Pricing
View Details