Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DEFB132 Rabbit pAb (APR20260N)

Product Specifications

Background

Defensins are cysteine-rich cationic polypeptides that are important in the immunologic response to invading microorganisms. The protein encoded by this gene is secreted and is a member of the beta defensin protein family. This protein binds spermatozoa and has antimicrobial activity against E. coli. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 20p13.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DEFB132 Rabbit pAb (APR20260N) .

Synonyms

DEFB132; BD-32; DEFB-32; DEFB32; HEL-75; KFLL827; UNQ827

Gene ID

400830

UniProt

Q7Z7B7

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 10kDa Observed MW: Refer to Figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=400830

Uniprot URL

https://www.uniprot.org/uniprot/Q7Z7B7

AA Sequence

MKFLLLVLAALGFLTQVIPASAGGSKCVSNTPGYCRTCCHWGETALFMCNASRKCCISYSFLPKPDLPQLIGNHWQSRRRNTQRKDKKQQTTVTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITGB1 Knockout Hela Polyclonal Cells
ARG37261 1 Million

ITGB1 Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
EIF2B1 (NM_001414) Human Over-expression Lysate
LS001967-100ug 100 µg

EIF2B1 (NM_001414) Human Over-expression Lysate

Sign In for Pricing
View Details
XPF (ERCC4) (NM_005236) Human Tagged Lenti ORF Clone
RC223300L2 10 µg

XPF (ERCC4) (NM_005236) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal TMEM119 Antibody (1023426) [FITC]
FAB10313F 0.1 mL

Mouse Monoclonal TMEM119 Antibody (1023426) [FITC]

Sign In for Pricing
View Details
Lipoyltransferase 1 mitochondrial (LIPT1) Mouse ELISA Kit
E7185 96 Tests

Lipoyltransferase 1 mitochondrial (LIPT1) Mouse ELISA Kit

Sign In for Pricing
View Details
TBL1XR1 Antibody
orb521716-01 50 μL

TBL1XR1 Antibody

Sign In for Pricing
View Details