Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DEFB132 Rabbit pAb (APR20260N)

Product Specifications

Background

Defensins are cysteine-rich cationic polypeptides that are important in the immunologic response to invading microorganisms. The protein encoded by this gene is secreted and is a member of the beta defensin protein family. This protein binds spermatozoa and has antimicrobial activity against E. coli. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 20p13.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DEFB132 Rabbit pAb (APR20260N) .

Synonyms

DEFB132; BD-32; DEFB-32; DEFB32; HEL-75; KFLL827; UNQ827

Gene ID

400830

UniProt

Q7Z7B7

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 10kDa Observed MW: Refer to Figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=400830

Uniprot URL

https://www.uniprot.org/uniprot/Q7Z7B7

AA Sequence

MKFLLLVLAALGFLTQVIPASAGGSKCVSNTPGYCRTCCHWGETALFMCNASRKCCISYSFLPKPDLPQLIGNHWQSRRRNTQRKDKKQQTTVTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC*Rabbit Anti Duck IgY (IgG)
SA0234 100 µL

FITC*Rabbit Anti Duck IgY (IgG)

Sign In for Pricing
View Details
FOXD3 DNA-Binding ELISA Kit (OKAG00391)
OKAG00391 96 Well

FOXD3 DNA-Binding ELISA Kit (OKAG00391)

Sign In for Pricing
View Details
SUPER-X PLEX ® Human IL-16 Flow Cytometry Assay - Group 3
HX16021 96 Tests

SUPER-X PLEX ® Human IL-16 Flow Cytometry Assay - Group 3

Sign In for Pricing
View Details
GnRHR Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-23169R-BF680-01 20 µL

GnRHR Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
GnRHR Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-23169R-BF680-02 100 µL

GnRHR Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Coilin (COIL) (NM_004645) Human Tagged Lenti ORF Clone
RC203119L2 10 µg

Coilin (COIL) (NM_004645) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details