Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOX14 Rabbit pAb (APR20246N)

Product Specifications

Background

This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. Mutations in this gene are suggested to be responsible for the limb defects associated with blepharophimosis, ptosis, epicanthus inversus syndrome (BPES) and Mobius syndrome.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SOX14 Rabbit pAb (APR20246N) .

Synonyms

SOX14; SOX28

Gene ID

8403

UniProt

O95416

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 26kDa Observed MW: Refer to Figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8403

Uniprot URL

https://www.uniprot.org/uniprot/O95416

AA Sequence

RYVFPLPYLGDTDPLKAAGLPVGASDGLLSAPEKARAFLPPASAPYSLLDPAQFSSSAIQKMGEVPHTLATGALPYASTLGYQNGAFGSLSCPSQHTHTHPSPTNPGYVVPCNCTAWSASTLQPPVAYILFPGMTKTGIDPYSSAHATAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KRTAP4-7 activation kit by CRISPRa
GA119166 1 Kit

Human KRTAP4-7 activation kit by CRISPRa

Sign In for Pricing
View Details
Clstn2 Mouse Gene Knockout Kit (CRISPR)
KN503495 1 Kit

Clstn2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pyromeconic Acid
TRC-P997600-500MG 500 mg

Pyromeconic Acid

Sign In for Pricing
View Details
Sox7 Mouse Gene Knockout Kit (CRISPR)
KN516502 1 Kit

Sox7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cd44 Rat Monoclonal Antibody [Clone ID: IM7.8.1]
CL024FX 300 µg

Cd44 Rat Monoclonal Antibody [Clone ID: IM7.8.1]

Sign In for Pricing
View Details
CPT1C (C-term) Rabbit Polyclonal Antibody
AP51065PU-N 400 µL

CPT1C (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details