Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LSP1 Rabbit pAb (APR20200N)

Product Specifications

Background

This gene encodes an intracellular F-actin binding protein. The protein is expressed in lymphocytes, neutrophils, macrophages, and endothelium and may regulate neutrophil motility, adhesion to fibrinogen matrix proteins, and transendothelial migration. Alternative splicing results in multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality LSP1 Rabbit pAb (APR20200N) .

Synonyms

LSP1; WP34; pp52

Gene ID

4046

UniProt

P33241

Cellular Locus

Cell membrane, Cytoplasmic side, Peripheral membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 30kDa/37kDa/50kDa Observed MW: 57kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4046

Uniprot URL

https://www.uniprot.org/uniprot/P33241

AA Sequence

MAEASSDPGAEEREELLGPTAQWSVEDEEEAVHEQCQHERDRQLQAQDEEGGGHVPERPKQEMLLSLKPSEAPELDEDEGFGDWSQRPEQRQQHEGAQGALDSGEPPQCRSPEGEQEDRPGLHAYEKEDSDEVHLEELSLSKEGPGPEDTVQDNLGAAGAEEEQEEHQKCQQPRTPSPLVLEGTIEQSSPPLSPTTKLIDRTESLNRSIEKSNSVKKSQPDLPISKIDQWLEQYTQAIETAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQKGGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALS (IGFALS) (NM_004970) Human Recombinant Protein
TP306542L 1 mg

ALS (IGFALS) (NM_004970) Human Recombinant Protein

Sign In for Pricing
View Details
COVID-19 TaqMan RT-PCR Kit (E/RdRP genes) -500p
TM67200 500 Reactions

COVID-19 TaqMan RT-PCR Kit (E/RdRP genes) -500p

Sign In for Pricing
View Details
GRP94 / HSP90B1 (Glucose-Regulated Protein 94) (Endoplasmic Reticulum Marker) (HSP90B1/3168R), CF405S conjugate, 0.1mg/mL
BNC043168-100 1x 100 µL

GRP94 / HSP90B1 (Glucose-Regulated Protein 94) (Endoplasmic Reticulum Marker) (HSP90B1/3168R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FABP4 (NM_001442) Human Over-expression Lysate
LY400558 100 µg

FABP4 (NM_001442) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) Rabbit Polyclonal Antibody
AP06205PU-N 100 µg

Cytokeratin 8 (KRT8) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FADS6 Human Gene Knockout Kit (CRISPR)
KN415372 1 Kit

FADS6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details