Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLRD1 Rabbit pAb (APR20198N)

Product Specifications

Background

Natural killer (NK) cells are a distinct lineage of lymphocytes that mediate cytotoxic activity and secrete cytokines upon immune stimulation. Several genes of the C-type lectin superfamily, including members of the NKG2 family, are expressed by NK cells and may be involved in the regulation of NK cell function. KLRD1 (CD94) is an antigen preferentially expressed on NK cells and is classified as a type II membrane protein because it has an external C terminus. Three transcript variants encoding two different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KLRD1 Rabbit pAb (APR20198N) .

Synonyms

KLRD1; CD94

Gene ID

3824

UniProt

Q13241

Cellular Locus

Membrane, Single-pass type II membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 17kDa/20kDa Observed MW: 43kDa/28kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3824

Uniprot URL

https://www.uniprot.org/uniprot/Q13241

AA Sequence

KNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti G6PD Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Immunofluorescence) 200ul
IRBAMLG6PDAP188200UL 200 µL

Rabbit Anti G6PD Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Immunofluorescence) 200ul

Sign In for Pricing
View Details
CLIA Kit for Transcription Elongation Factor A Like Protein 3 (TCEAL3)
MBS2000550-01 24 Strip Well

CLIA Kit for Transcription Elongation Factor A Like Protein 3 (TCEAL3)

Sign In for Pricing
View Details
CLIA Kit for Transcription Elongation Factor A Like Protein 3 (TCEAL3)
MBS2000550-02 48 Well

CLIA Kit for Transcription Elongation Factor A Like Protein 3 (TCEAL3)

Sign In for Pricing
View Details
CLIA Kit for Transcription Elongation Factor A Like Protein 3 (TCEAL3)
MBS2000550-03 96 Well

CLIA Kit for Transcription Elongation Factor A Like Protein 3 (TCEAL3)

Sign In for Pricing
View Details
CLIA Kit for Transcription Elongation Factor A Like Protein 3 (TCEAL3)
MBS2000550-04 5x 96 Well

CLIA Kit for Transcription Elongation Factor A Like Protein 3 (TCEAL3)

Sign In for Pricing
View Details
CLIA Kit for Transcription Elongation Factor A Like Protein 3 (TCEAL3)
MBS2000550-05 10x 96 Well

CLIA Kit for Transcription Elongation Factor A Like Protein 3 (TCEAL3)

Sign In for Pricing
View Details