Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF4G2 Rabbit pAb (APR20193N)

Product Specifications

Background

Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. The protein encoded by this gene shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3; eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, this gene product functions as a general repressor of translation by forming translationally inactive complexes. In vitro and in vivo studies indicate that translation of this mRNA initiates exclusively at a non-AUG (GUG) codon. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EIF4G2 Rabbit pAb (APR20193N) .

Synonyms

EIF4G2; AAG1; DAP5; NAT1; P97

Gene ID

1982

UniProt

P78344

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 98kDa/102kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1982

Uniprot URL

https://www.uniprot.org/uniprot/P78344

AA Sequence

IYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ELP4 Rabbit Monoclonal Antibody, Carrier-free
M07167-1-carrier-free 100 µL

Anti-ELP4 Rabbit Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
Klkb21 shRNA (m) Lentiviral Particles
sc-146551-V 200 µL

Klkb21 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Recombinant ASFV TMK Protein (aa 1-235)
VAng-0971Lsx-1mg 1 mg

Recombinant ASFV TMK Protein (aa 1-235)

Sign In for Pricing
View Details
M71-125-1-342YL AF Systems Consumables
114940 Box of 100 Label(s)

M71-125-1-342YL AF Systems Consumables

Sign In for Pricing
View Details
EEF2K Protein Vector (Rat) (pPB-C-His)
PV265470 500 ng

EEF2K Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral mouse Oxa1l shRNA (UAS) - Lentiviral mouse Oxa1l shRNA (UAS, RFP) (100)
GTR15284928 1 Vial

Lentiviral mouse Oxa1l shRNA (UAS) - Lentiviral mouse Oxa1l shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details