Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDKN1B/p27KIP1 Rabbit pAb (APR20191N)

Product Specifications

Background

This gene encodes a cyclin-dependent kinase inhibitor, which shares a limited similarity with CDK inhibitor CDKN1A/p21. The encoded protein binds to and prevents the activation of cyclin E-CDK2 or cyclin D-CDK4 complexes, and thus controls the cell cycle progression at G1. The degradation of this protein, which is triggered by its CDK dependent phosphorylation and subsequent ubiquitination by SCF complexes, is required for the cellular transition from quiescence to the proliferative state. Mutations in this gene are associated with multiple endocrine neoplasia type IV (MEN4) .

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CDKN1B/p27KIP1 Rabbit pAb (APR20191N) .

Synonyms

CDKN1B; CDKN4; KIP1; MEN1B; MEN4; P27KIP1; p27 KIP 1

Gene ID

1027

UniProt

P46527

Cellular Locus

Cytoplasm, Endosome, Nucleus

Dilution

WB 1:500 - 1:1000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 22kDa Observed MW: 26kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1027

Uniprot URL

https://www.uniprot.org/uniprot/P46527

AA Sequence

MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Violet 500 Anti-Mouse CD16/32 Antibody[2.4G2]
E-AB-F0997UR-01 25 µg

Elab Fluor® Violet 500 Anti-Mouse CD16/32 Antibody[2.4G2]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Anti-Mouse CD16/32 Antibody[2.4G2]
E-AB-F0997UR-02 100 µg

Elab Fluor® Violet 500 Anti-Mouse CD16/32 Antibody[2.4G2]

Sign In for Pricing
View Details
Human CCDC121 activation kit by CRISPRa
GA112507 1 Kit

Human CCDC121 activation kit by CRISPRa

Sign In for Pricing
View Details
ISLR2 Antibody
KC-3804-01 50 μL

ISLR2 Antibody

Sign In for Pricing
View Details
ISLR2 Antibody
KC-3804-02 100 µL

ISLR2 Antibody

Sign In for Pricing
View Details
ISLR2 Antibody
KC-3804-03 1 mL

ISLR2 Antibody

Sign In for Pricing
View Details