Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyclin C Rabbit pAb (APR20189N)

Product Specifications

Background

The protein encoded by this gene is a member of the cyclin family of proteins. The encoded protein interacts with cyclin-dependent kinase 8 and induces the phophorylation of the carboxy-terminal domain of the large subunit of RNA polymerase II. The level of mRNAs for this gene peaks in the G1 phase of the cell cycle. Two transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Cyclin C Rabbit pAb (APR20189N) .

Synonyms

CCNC; CycC; SRB11; hSRB11; cyclin-C

Gene ID

892

UniProt

P24863

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 22kDa/33kDa Observed MW: 33kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=892

Uniprot URL

https://www.uniprot.org/uniprot/P24863

AA Sequence

MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXO4 Polyclonal Antibody, PE-Cy5 Conjugated
bs-2766R-PE-Cy5 100 µL

FOXO4 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Pig Tryptase (TPS) ELISA Kit
MBS2702886-01 24 Strip Well

Pig Tryptase (TPS) ELISA Kit

Sign In for Pricing
View Details
Pig Tryptase (TPS) ELISA Kit
MBS2702886-02 48 Well

Pig Tryptase (TPS) ELISA Kit

Sign In for Pricing
View Details
Pig Tryptase (TPS) ELISA Kit
MBS2702886-03 96 Well

Pig Tryptase (TPS) ELISA Kit

Sign In for Pricing
View Details
Pig Tryptase (TPS) ELISA Kit
MBS2702886-04 5x 96 Well

Pig Tryptase (TPS) ELISA Kit

Sign In for Pricing
View Details
Pig Tryptase (TPS) ELISA Kit
MBS2702886-05 10x 96 Well

Pig Tryptase (TPS) ELISA Kit

Sign In for Pricing
View Details