Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CREB3 Rabbit pAb (APR20161N)

Product Specifications

Background

This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-response element and regulates cell proliferation. The protein interacts with host cell factor C1, which also associates with the herpes simplex virus (HSV) protein VP16 that induces transcription of HSV immediate-early genes. This protein and VP16 both bind to the same site on host cell factor C1. It is thought that the interaction between this protein and host cell factor C1 plays a role in the establishment of latency during HSV infection. This protein also plays a role in leukocyte migration, tumor suppression, and endoplasmic reticulum stress-associated protein degradation. Additional transcript variants have been identified, but their biological validity has not been determined.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CREB3 Rabbit pAb (APR20161N) .

Synonyms

CREB3; LUMAN; LZIP; sLZIP

Gene ID

10488

UniProt

O43889

Cellular Locus

Cytoplasm, Endoplasmic reticulum membrane, Membrane, Nucleus, Single-pass type II membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 39kDa/41kDa/43kDa Observed MW: 44kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10488

Uniprot URL

https://www.uniprot.org/uniprot/O43889

AA Sequence

MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTC

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RBPJ (CBF 1, CBF-1, CBF1, IGKJRB1, J kappa recombination Signal Binding Protein, J kappa-recombination Signal Binding Protein, J kappa-recombination Signal-Binding Protein, KBF2, NY REN 30 Antigen, RBP J kappa, RBP-J, RBP-J kappa, RBP-JK, Rbpj, RBPJK, RBPSUH, Recombining Binding Protein Suppressor of hairless, Renal Carcinoma Antigen NY-REN-30, SUH_HUMAN, ) discontinued
225505-01 50 µL

RBPJ (CBF 1, CBF-1, CBF1, IGKJRB1, J kappa recombination Signal Binding Protein, J kappa-recombination Signal Binding Protein, J kappa-recombination Signal-Binding Protein, KBF2, NY REN 30 Antigen, RBP J kappa, RBP-J, RBP-J kappa, RBP-JK, Rbpj, RBPJK, RBPSUH, Recombining Binding Protein Suppressor of hairless, Renal Carcinoma Antigen NY-REN-30, SUH_HUMAN, ) discontinued

Ask
View Details
RBPJ (CBF 1, CBF-1, CBF1, IGKJRB1, J kappa recombination Signal Binding Protein, J kappa-recombination Signal Binding Protein, J kappa-recombination Signal-Binding Protein, KBF2, NY REN 30 Antigen, RBP J kappa, RBP-J, RBP-J kappa, RBP-JK, Rbpj, RBPJK, RBPSUH, Recombining Binding Protein Suppressor of hairless, Renal Carcinoma Antigen NY-REN-30, SUH_HUMAN, ) discontinued
225505-02 100 µL

RBPJ (CBF 1, CBF-1, CBF1, IGKJRB1, J kappa recombination Signal Binding Protein, J kappa-recombination Signal Binding Protein, J kappa-recombination Signal-Binding Protein, KBF2, NY REN 30 Antigen, RBP J kappa, RBP-J, RBP-J kappa, RBP-JK, Rbpj, RBPJK, RBPSUH, Recombining Binding Protein Suppressor of hairless, Renal Carcinoma Antigen NY-REN-30, SUH_HUMAN, ) discontinued

Ask
View Details
EEF1G, Recombinant, Human, aa1-437, His-Tag (Elongation Factor 1-Gamma, EF1G, GIG35)
218123-01 100 µg

EEF1G, Recombinant, Human, aa1-437, His-Tag (Elongation Factor 1-Gamma, EF1G, GIG35)

Ask
View Details
EEF1G, Recombinant, Human, aa1-437, His-Tag (Elongation Factor 1-Gamma, EF1G, GIG35)
218123-02 500 µg

EEF1G, Recombinant, Human, aa1-437, His-Tag (Elongation Factor 1-Gamma, EF1G, GIG35)

Ask
View Details
CD69 antibody (PE)
61R-CD69aMSPE 200 ug

CD69 antibody (PE)

Ask
View Details
Tuftelin-Interacting Protein 11 (TFIP11) Antibody
abx238633 100 µg

Tuftelin-Interacting Protein 11 (TFIP11) Antibody

Ask
View Details